KEGG   Thermotoga maritima: THEMA_05005Help
Entry
THEMA_05005       CDS       T02976                                 

Definition
alpha-amlyase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
tmi  Thermotoga maritima
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    THEMA_05005
Enzymes [BR:tmi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     THEMA_05005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(997862..999523)
Genome map
AA seq 553 aa AA seqDB search
MKKPFLLLAFVFLLFLTSCFQTSMSQSLVSSNPHSNSTNTDGTSSNLEEVKYPVVYEIFI
RSFYDRDGNGVGDLNGVSQKVDYLKELGVDAVWFMPFNEAVSYHGYDITDYYNVEKDYGT
MEDLENMIQVLHENGIKVIMDLVINHTSDEHPWFKDAVENTTSSPYWDYYIMSLEDHSGQ
DHWHWKINSKGQKVWYFGLFGYNMPDLNHDSQKVREEVKKIVDFWISKGVDGFRIDAAKH
IYGWSWDDGIQESAEYFEWFRDYVLSKKPDAILVGEVFSGNTYDLSLYPIPVFNFALMYS
IRNYPEGQDGMIENNWVEESFLFLENHDLHRFFSHLQEHYKKFSESDYEFIKKRAALWYF
LIFTLKGSPVIYYGGEIGTRGFKWHGPVYDEPVREPMQWYASGTGEGQTFWTKEVYKNAG
ITFGNADVDGCIYDDPYDGFSVEEQESDPKSLLNFIRFILNFRKDHDAILNGDQTIFRDW
KNLIAFYRESSNEKLLVVLNPDPVWQNSFTFEENMTMILEVDFENFIWNESNVSFSAGES
FTVDPMKAYIFKK
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaagccttttttactgcttgcttttgtgtttttactcttcctcacctcctgcttt
caaacgtctatgagtcaatccctcgtttcaagtaatccacattcaaacagcacaaacaca
gatggtactagctccaaccttgaagaagtaaaataccccgtcgtctacgaaattttcatt
cgctctttttacgacagagacgggaacggagtgggagatttaaacggtgtttctcagaaa
gttgattatctgaaggaactcggcgttgacgctgtgtggtttatgcccttcaacgaggct
gtttcataccatggatacgacataacagactactacaacgtcgagaaagactacggcacc
atggaagatctcgaaaacatgatccaggtgctccatgagaacggaataaaggtaataatg
gatctcgtgatcaaccacacatccgatgagcatccctggttcaaagacgccgtggaaaac
acgaccagctctccgtactgggactactacataatgagtcttgaagatcattctggtcag
gatcactggcactggaagatcaactcaaagggtcaaaaagtctggtatttcggacttttt
ggctataacatgccggatctgaaccacgacagtcagaaagtgagagaagaagtaaagaaa
atcgtggatttctggatttccaaaggtgttgatggattcagaatagatgctgcaaagcac
atatatggctggtcctgggacgatgggatacaggagtcggccgaatattttgaatggttc
agagattatgtgctttccaaaaagcccgatgccatacttgtgggagaggtgttcagcgga
aacacgtacgatctttctctatatccaattcccgttttcaatttcgccctcatgtacagt
ataaggaactacccagaagggcaggatggaatgatagaaaacaactgggttgaggagtct
ttcctgtttcttgagaatcacgatctccacaggttcttctcccatcttcaagaacattac
aaaaagttctccgagtccgactacgagttcatcaaaaaacgtgctgctctctggtatttt
ctgatattcacactgaaaggatctcctgttatctactacggcggtgaaattggaacgaga
ggtttcaagtggcacggtcctgtatatgacgagccggtgagagagccgatgcagtggtac
gcaagcggtacaggagaaggtcaaaccttctggacaaaggaagtctacaaaaacgcgggg
ataacctttggaaacgctgatgttgacggatgtatctatgacgatccttacgatggcttt
tctgtcgaagaacaggaaagcgatccgaagagtcttttgaatttcatcagattcattctc
aacttcagaaaagatcacgacgccattttgaatggagatcaaacgatcttcagggactgg
aaaaacctcatagcgttctacagagaatcctccaacgaaaagctgttggtggtcttgaat
ccggatccagtctggcaaaacagcttcacttttgaagaaaacatgacgatgattctcgag
gtagattttgaaaacttcatctggaacgagtcaaacgtgtctttttcagcgggtgaatcc
ttcactgtggatcccatgaaagcgtacattttcaaaaagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system