KEGG   Thermotoga maritima: THEMA_09250Help
Entry
THEMA_09250       CDS       T02976                                 

Definition
esterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
tmi  Thermotoga maritima
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1772843..1773604
Genome map
AA seq 253 aa AA seqDB search
MNFPRCKTVKKSLPIFLEGGNEGVLFIHGYTGSPHDFEYMAKEVNRAGFTVSVPRLPGHG
TCGEDFLTTTARDWLRRAFDAYYDLKAICDRVYVVGLSMGGVIALILASQMNPPKLVTLA
AATHVFDKRIVLTPILKLFTKKMPCENTEKYEDPDIEYLRKEYWSYNWPKQAAELYKLMK
LARKSVSKITSATLVVAAKNDNMVPMKAAEFIYNNIRSEKRKLLVFEKSGHVLSNDVEKE
DVTRAVIEWLKGE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaattttccacgatgtaaaactgtgaagaagtcgcttccgatctttcttgagggagga
aacgaaggggttcttttcatccatggatacaccggttctccacacgatttcgagtacatg
gcaaaggaggtaaacagagccggctttaccgtttctgttccgagacttccaggacacgga
acctgcggtgaggattttctgacgacaaccgctcgagactggctgagacgcgctttcgat
gcatattacgatttaaaagccatatgcgatagagtctatgtggtgggactttccatgggt
ggtgtgattgctctgatccttgcctctcagatgaatcctcccaaactggtcacactggct
gcagcaactcatgtgttcgacaaaagaatagttctcacaccgattctgaagttgtttacg
aagaagatgccttgtgaaaacacagaaaagtacgaagacccggacatcgaatacctgaga
aaagagtactggtcttacaactggccaaaacaggcagctgagctttacaaactcatgaaa
ctggcaagaaagagtgtttcaaagatcacatcagccactctcgtcgtcgcggcaaaaaac
gacaacatggttcccatgaaggcagccgagttcatatacaacaacatcagatcagaaaag
aggaagcttcttgtttttgaaaaatccggtcacgttctgagcaacgatgtggaaaaggaa
gatgtcaccagagcagttatcgagtggctgaagggggaatga

DBGET integrated database retrieval system