KEGG   Thermotoga maritima: THEMA_09545Help
Entry
THEMA_09545       CDS       T02976                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
tmi  Thermotoga maritima
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tmi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    THEMA_09545
Enzymes [BR:tmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     THEMA_09545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1837137..1838027
Genome map
AA seq 296 aa AA seqDB search
MISVVGSSNIDIVLKVDHFTKPGETQKAIEMNVFPGGKGANQAVTVAKIGEKGCRFVTCI
GNDDYSDLLIENYEKLGITGYIRVSLPTGRAFIEVDKTGQNRIIIFPGANAELKKELIDW
NTLSESDILLLQNEIPFETTLECAKRFNGIVIFDPAPAQGINEEIFQYLDYLTPNEKEIE
ALSKDFFGEFLTVEKAAEKFLELGVKNVIVKLGDKGVLLVNKNEKKHFPTFKVKAVDTTA
AGDVFNGAFAVALSEGKNPEEAVIFGTAAAAISVTRLGAQSSIPAREEVEAFLKNL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgatttccgtcgtggggagttcaaacatagatatcgttctgaaggttgatcacttcaca
aaacctggtgaaacccagaaagcgatagagatgaacgtttttccgggtggaaaaggggcg
aatcaggctgtaacagtcgcaaaaattggagagaaaggatgccgttttgtaacgtgcatt
ggaaacgatgattactctgatctgctcatagagaattacgaaaaactcggaataactgga
tatataagagttagtcttcctacaggaagagcgttcatagaagtcgataaaacaggacaa
aacaggatcatcatctttcctggagcgaacgccgaactgaaaaaagaattgattgattgg
aatacgctctctgaaagtgatatccttctccttcaaaacgaaattccttttgaaaccacc
ttggaatgtgcgaaaagattcaatggaattgtgatctttgaccccgcacccgcgcaggga
ataaacgaagaaatctttcagtacctggactatctcacaccgaatgaaaaagagatcgaa
gccctgtcgaaagatttcttcggtgagtttttgacggttgagaaagccgctgagaagttt
ctggaactcggcgtcaagaatgtgatagtgaagctcggtgacaaaggagtacttcttgtg
aacaaaaatgaaaagaaacactttccgaccttcaaagtaaaggctgtggacacaacagcg
gcgggggacgtgttcaatggagcttttgccgttgctctgtctgagggaaaaaatcccgaa
gaggcggtaatctttggaacggcagcagcggccatatcggtaacaaggttgggagctcaa
agttctattccagcgagagaagaagtagaggcgtttttgaagaatttatga

DBGET integrated database retrieval system