KEGG   Tuber melanosporum: GSTUM_00000270001Help
Entry
GSTUM_00000270001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
tml  Tuber melanosporum
Brite
Exosome [BR:tml04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   GSTUM_00000270001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 138 aa AA seqDB search
MPPKAAEKKPTTAGKAPAGKAPEKKEAGKKTAAASGEKKKRSKTRKETYSSYIYKVLKQV
HPDTGISNRAMSILNSFVNDIFERVATEASKLAAYNKKSTISSREIQTSVRLILPGELAK
HAVSEGTKAVTKYSSSTK
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgcctccaaaagctgctgagaagaagcccaccaccgccggaaaggcaccggccggaaag
gcccctgagaagaaggaggctggaaagaagaccgctgccgccagtggcgagaagaagaag
cgctccaagaccagaaaggagacttactcttcatacatctacaaggttttgaagcaggtc
caccctgacaccggtatttccaaccgtgctatgtccattctcaactccttcgtcaatgat
attttcgagcgtgttgcgactgaggcctcgaagcttgctgcatataacaagaagtctacc
atttcttctcgcgagatccagacttctgtccgcttgatcctccccggtgagcttgccaag
cacgccgtttctgagggcaccaaggccgtcaccaagtactcttcctctaccaaataa

DBGET integrated database retrieval system