KEGG   Tuber melanosporum: GSTUM_00000274001Help
Entry
GSTUM_00000274001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tml  Tuber melanosporum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GSTUM_00000274001
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GSTUM_00000274001
  Amino acid metabolism
   00310 Lysine degradation
    GSTUM_00000274001
Enzymes [BR:tml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     GSTUM_00000274001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 441 aa AA seqDB search
MACRRLAMRRLPLAATPSVALSATSVSSCRQASVRPFSRLSQYKDGLLGSASRNSQQFFN
ASSIFNLQVRSYASMVIKVPAMAESISEGTLKQFSKKVGDFVLQDEEIATIETDKIDVAV
NAPEAGTITELLVEEEATVTVGQDLVKLELGGAPEESGGKQEAAEGESKAPADAVQESGN
KQAPPKEEREEGEPPVAPSQEGLGNREEKRVKMNRMRLRIAERLKQSQNTAASLTTFNEV
DMSALMEMRKLYKDKVLEKTGVKLGFMSAFTRACVLASRDVPTVNASIEGPDGGDTIVYR
DYVDVSVAVATEKGLVTPVVRNAEALDFVGIEKAIAELGKKARDAKLTIEDMAGGTFTIS
NGGVFGSLYGTPIINLPQTAVLGLHAIKDRPVAINGKIEIRPMMYLALTYDHRLLDGREA
VTFLVKVKDYIEDPRRMLLGI
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggcttgtcgtagattagctatgcgtcgcttgcctctggcagctactcctagtgtggct
ctctccgccacttccgtttcctcgtgccgccaagcttcggtacggcccttttcacggcta
tcacaatacaaggatggactcttgggaagtgcctctaggaattcgcaacaattttttaat
gcatcatcgatcttcaatctccaagtccgatcttatgcgagtatggttatcaaggttccc
gcaatggccgagtcgatttcggaggggacgctgaagcagttctccaaaaaggttggagac
tttgtgctgcaggatgaagagatcgcgaccattgaaaccgataaaatcgatgtcgctgtc
aatgccccggaggcgggcacgattaccgagcttctcgtcgaggaggaggccaccgtcacc
gtcggccaggatcttgtcaagctggaattagggggagctccggaggaaagcggtggaaag
caggaagcggctgaaggagagtcgaaagcgccggcagatgctgtccaagagtccggaaac
aaacaggcgcctcctaaggaagagcgcgaggagggcgagccgcctgtcgcccccagccaa
gaagggctcggcaaccgcgaggagaagcgtgtgaaaatgaaccgcatgcgtctcagaatt
gcggaacgcttgaaacaatcccagaacaccgccgcatccctgacaacatttaatgaagta
gacatgtctgccctcatggaaatgaggaagttgtacaaggacaaggttcttgagaagacc
ggtgtcaagcttggtttcatgagcgcattcacccgggcttgtgttcttgcctcgagggat
gtcccgaccgtcaatgcctcgattgaagggccagacggcggcgacaccattgtgtaccgc
gactatgtcgatgttagtgttgccgttgcgacagaaaaggggcttgttacccccgtggtg
cggaatgccgaagctttagactttgtggggattgaaaaggccattgccgaactgggcaag
aaggcgagggatgcgaaactcaccatagaggatatggcgggtggaacttttaccatctct
aacggtggtgtctttggttccctttacggtaccccgataatcaaccttccacaaaccgct
gtgttggggcttcacgccatcaaggacaggccggttgctattaacgggaagatcgagata
agaccgatgatgtaccttgccctcacctacgatcaccgtctcctcgacggccgcgaggca
gtcaccttcctagtaaaggtgaaggattacattgaggatccccgccgcatgttgttaggc
atttaa

DBGET integrated database retrieval system