KEGG   Tuber melanosporum: GSTUM_00000323001Help
Entry
GSTUM_00000323001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
tml  Tuber melanosporum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tml00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 454 aa AA seqDB search
MARDWIHWKDNSTKGLPIDEMMIGQIRTRSSDSYVTDSASSATAYSCGIKTFNGGIAVDD
DQEPCGTVLEAAKLKGFMTGLIVTSRITHATPASYVAHIYDRDKEANIALQEIGYTHPLG
RTVDILMGGGRCYFTPQKTASSCRKDDIDALAIARTLGYTVFEDRATFDKDVNLPYLGLF
TQDHMSYEIDRDPKKEPSLTEMAIKGLNDLYKATKKSKEGFFVLVEASRIDHAGHANDPT
GHLHDILEYNHAMDAMREWIDEHDDSPTVLISTADHECGGLTLGYVIDGAPEYWFAPGYF
ENSKSSTEKLSRDWKAATTTDLARYARDNIFKPYGIMSPTNDEISRAIALRNTTSGFGVF
LGQAFSERLGVHWATLGHSAVDVTLYGHGVNHKDFAGQHENTEVAEFVAKQLDLDLDPIT
ERLRKNASWVRDNVKPQPGQTARLKGRDVARNHH
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcgattggattcactggaaggacaattccaccaagggattgccaatcgatgag
atgatgattggccaaattcgcactcgttctagcgattcgtacgtcaccgactcggccagt
tctgcgacagcgtactcgtgcggtatcaagactttcaatgggggaatagccgttgatgat
gatcaagagccctgtggaactgttttggaagctgctaagcttaagggattcatgactggg
cttattgttactagcagaatcactcatgctactccggcatcttatgtagctcacatctat
gatcgcgataaggaagcaaacattgccttgcaggaaattgggtacactcatccgttgggg
agaactgttgatatcttgatgggtggcggaagatgctattttacccctcagaaaactgct
tcctcgtgtagaaaggatgatatcgatgctcttgctatcgctagaactttggggtacaca
gttttcgaggacagggccaccttcgataaggatgttaatctaccttaccttggattgttt
actcaggaccacatgtcctacgaaattgaccgtgacccgaagaaggaaccttcgttaacc
gagatggccatcaaggggttgaatgatttgtacaaggcgaccaagaagtccaaggaaggc
ttctttgttttggttgaggcttcccgaattgatcatgctggccacgcaaatgatccgact
ggccatctccacgacattcttgagtacaaccacgccatggatgctatgcgcgaatggatc
gatgaacatgacgattcccccaccgttctcatctcaactgctgaccacgaatgcggtggt
ttgacactcggctacgtgattgatggtgctcctgagtactggttcgcgcctggatatttt
gagaactcaaagagctctaccgagaagctttcccgtgactggaaggccgctacaaccact
gaccttgctcgatacgcccgcgacaacattttcaaaccatacggaatcatgtcacccacc
aacgatgaaatttcccgcgcaatcgccctcaggaataccacttctggttttggggttttc
cttggtcaggctttcagcgagagacttggtgttcattgggctactctggggcactctgcc
gttgacgttaccctctatggacacggagtcaaccacaaggactttgcgggccaacatgaa
aacactgaggttgcggaattcgtcgccaagcaactcgacttggaccttgatcctatcacc
gagaggcttaggaaaaatgcttcctgggttagggataacgtcaagccccagcctgggcag
acggcgagactgaagggcagggatgttgctagaaaccatcattag

DBGET integrated database retrieval system