KEGG   Tuber melanosporum: GSTUM_00000424001Help
Entry
GSTUM_00000424001 CDS       T01282                                 

Definition
(RefSeq) hypothetical protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
tml  Tuber melanosporum
Pathway
tml00010  Glycolysis / Gluconeogenesis
tml01100  Metabolic pathways
tml01110  Biosynthesis of secondary metabolites
tml01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GSTUM_00000424001
Enzymes [BR:tml01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     GSTUM_00000424001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 9184393
NCBI-ProteinID: XP_002837629
INRA: GSTUM_00000424001
UniProt: D5GBC7
AA seq 303 aa AA seqDB search
MVERSKKPVPIPVSSTGAENPGFVLESDRVKLSLPTGESAEILLHGATVISWVVDGQEKL
FLSEKAALDGSKPVRGGIPLVFPVFGKSTEGPTAALPQHGFARLCKWELLGRTSEADTAI
QVDFGLGPENLTDDQRNQWPYEFGLIYSVNLSMSSLETKMLVRNEGSETFDFNVLFHTYF
RIPDINNLTIEGLKGTSYKCKVTKSEAVEEEVELPVRSEVDRVYAGVPNAVQVKNGGETI
FKVGGTNLEDIVVWNPWEGASKMADFGPEDGYKNMICVEAGAVSKWHSLEPQSVWEGSAV
VNI
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaacgcagcaagaagccggttccaattcccgtgagctctactggagcagaaaac
ccgggattcgttctcgagagcgaccgggtcaagttatctctacccactggggaatccgcc
gagatcttgctacacggtgctacggtgatttcctgggtagtcgatgggcaggaaaagctg
tttctgagcgaaaaggcggccctcgatggatcgaagcctgtaagaggtggaattccgctg
gtttttccggtgttcggaaaatccacggaaggacccaccgccgccctcccacagcacgga
tttgcgagactctgcaagtgggaactactcggccgaactagtgaagccgataccgcaatc
caggttgactttggtctcggtccggagaaccttaccgatgaccagcgcaatcaatggccc
tacgaatttggcctgatttactccgtgaacctaagcatgagcagtctcgagacaaaaatg
ctcgtcagaaatgaaggatcagaaacgtttgactttaacgttttgttccatacatatttt
cgtattcccgacataaacaatctcacaatcgaaggtctcaaaggcactagctacaaatgc
aaagttacaaaatctgaagccgtcgaggaagaggttgagctccccgtccgctctgaagtg
gatcgtgtatatgccggcgtcccaaacgcggtccaagtgaagaatggaggtgaaacaatc
ttcaaagtcggcggaaccaatctggaagatatagttgtctggaacccctgggagggcgcg
agcaagatggcggactttgggcccgaagatgggtacaagaacatgatctgcgttgaggcg
ggagctgtgtcgaaatggcattccctcgaaccgcagagcgtctgggaggggagcgctgtt
gtcaatatttga

DBGET integrated database retrieval system