KEGG   Tuber melanosporum: GSTUM_00000424001Help
Entry
GSTUM_00000424001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
tml  Tuber melanosporum
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tml00010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 303 aa AA seqDB search
MVERSKKPVPIPVSSTGAENPGFVLESDRVKLSLPTGESAEILLHGATVISWVVDGQEKL
FLSEKAALDGSKPVRGGIPLVFPVFGKSTEGPTAALPQHGFARLCKWELLGRTSEADTAI
QVDFGLGPENLTDDQRNQWPYEFGLIYSVNLSMSSLETKMLVRNEGSETFDFNVLFHTYF
RIPDINNLTIEGLKGTSYKCKVTKSEAVEEEVELPVRSEVDRVYAGVPNAVQVKNGGETI
FKVGGTNLEDIVVWNPWEGASKMADFGPEDGYKNMICVEAGAVSKWHSLEPQSVWEGSAV
VNI
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaacgcagcaagaagccggttccaattcccgtgagctctactggagcagaaaac
ccgggattcgttctcgagagcgaccgggtcaagttatctctacccactggggaatccgcc
gagatcttgctacacggtgctacggtgatttcctgggtagtcgatgggcaggaaaagctg
tttctgagcgaaaaggcggccctcgatggatcgaagcctgtaagaggtggaattccgctg
gtttttccggtgttcggaaaatccacggaaggacccaccgccgccctcccacagcacgga
tttgcgagactctgcaagtgggaactactcggccgaactagtgaagccgataccgcaatc
caggttgactttggtctcggtccggagaaccttaccgatgaccagcgcaatcaatggccc
tacgaatttggcctgatttactccgtgaacctaagcatgagcagtctcgagacaaaaatg
ctcgtcagaaatgaaggatcagaaacgtttgactttaacgttttgttccatacatatttt
cgtattcccgacataaacaatctcacaatcgaaggtctcaaaggcactagctacaaatgc
aaagttacaaaatctgaagccgtcgaggaagaggttgagctccccgtccgctctgaagtg
gatcgtgtatatgccggcgtcccaaacgcggtccaagtgaagaatggaggtgaaacaatc
ttcaaagtcggcggaaccaatctggaagatatagttgtctggaacccctgggagggcgcg
agcaagatggcggactttgggcccgaagatgggtacaagaacatgatctgcgttgaggcg
ggagctgtgtcgaaatggcattccctcgaaccgcagagcgtctgggaggggagcgctgtt
gtcaatatttga

DBGET integrated database retrieval system