KEGG   Tuber melanosporum: GSTUM_00000447001Help
Entry
GSTUM_00000447001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
tml  Tuber melanosporum
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:tml00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    GSTUM_00000447001
Enzymes [BR:tml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     GSTUM_00000447001
Protein kinases [BR:tml01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   GSTUM_00000447001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 356 aa AA seqDB search
MAQSQETGNNSTGNSSQEKPSEEQQRQQQAAVRTTKGKYSLSDFTISRTLGTGSFGRVHL
VQSRHNLRFYAVKVLKKAQVVKMKQVEHTNDERRMLQKVKHPFLITLWGTFQDGKNLYMV
MDFIEGGELFSLLRKSQRFPNPVAKFYAAEVALALDYLHSHHIIYRDLKPENLLLDRHGH
LKITDFGFAKEVPDITWTLCGTPDYLAPEVVASKGYNKSVDWWSLGILIFEMLCGYTPFW
DGGSPMKIYENILKGRVKYPAYIHPDAQDLLQQLITPDLTKRLGNLLHGSSDIKQHQWFA
EVNWDRLAKRDIEAPYVPPVRGGVGDSSQFDRYPEEQDEYGVDDGFDQHGHLFEEF
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaatcacaagagacgggaaataattccactggaaattcttcgcaagagaagccg
tctgaagagcagcagcggcagcaacaagctgctgttaggacgactaaaggaaagtattcc
ttgagcgatttcactatttcgcggaccctaggtactgggagttttggtcgtgtacacctt
gtccagtcacggcacaacctccgcttttatgctgtcaaggtcctcaaaaaggcacaggtt
gtaaagatgaaacaggtagagcataccaacgacgagcggcgcatgttacagaaagttaag
caccccttcttgataacgttgtggggaactttccaggatggcaagaatctttatatggtg
atggatttcatcgaaggaggggaactctttagtctgctacggaagtcgcagcgatttccg
aaccccgttgctaaattctatgctgcggaggttgctcttgccctcgattacctgcactct
caccacataatctaccgagatctcaaaccggaaaatctgctcctagaccggcacggccat
ctgaagattacggatttcggttttgccaaggaggttccagacataacctggacgctctgc
ggcactccggattatctagcgccggaggtagttgcttcgaaaggatacaataaatctgtg
gactggtggtccctcggtatccttatcttcgaaatgctctgcggttataccccattctgg
gacggaggcagccctatgaagatctacgaaaacatcctcaaaggccgagtcaaataccct
gcatatatccatcccgacgctcaagacctcctccaacaattgatcacccctgatctaaca
aaacgcctggggaatttattgcacgggagtagtgatatcaagcaacaccaatggttcgca
gaagtcaactgggatcgcttagcaaagagagacattgaagccccatacgtaccgccagtg
cgtggaggagtaggcgattcgagtcagttcgaccggtacccggaagagcaagatgagtat
ggggtagacgatggattcgatcaacacgggcatctttttgaggagttttga

DBGET integrated database retrieval system