KEGG   Tuber melanosporum: GSTUM_00000458001Help
Entry
GSTUM_00000458001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
tml  Tuber melanosporum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GSTUM_00000458001
  Amino acid metabolism
   00330 Arginine and proline metabolism
    GSTUM_00000458001
Enzymes [BR:tml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     GSTUM_00000458001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 420 aa AA seqDB search
MNLSSEFDRFGGYSTSMKGKRALTIVIKLGTSSICDERTHDPLLSNLSLLVETAVRLRRD
GHRVILVSSGAIGIGLRRLDIEKRPKHLSAAQAIAAVGQCRLIALWDALFTQLQQPVAQV
LLTRNDIADRTQYLNASNTFAELLSMGIIPIVNENDTLAVNEIKFGDNDTLSAITAGMVN
ADYLFLMTDVDCLYTDNPRTHPNAQPIEVVEDISTLKVDVSSTGSTLGTGGMATKLTAAR
LATSAGVTTIITRSSIPSNIFHIVAYIQSLKEADPNTQPQTPTIPPSHPLHTRFLAKPRA
LRDRYFWILHGLAPHGTVYIDEGAYGALTRRDKAGLLPVGVVDVAGTFAQQEAVNLAVVQ
RIVGGGYVIKGPEVGKALVNYSSTEIARIMGQQSSKIQELLGYAGMYFHLLSSPFILPRW
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaatctttcttcagaatttgatcgttttgggggatactcaacgagcatgaagggaaaa
cgtgctttgacgattgttatcaagcttggaacttcatctatctgtgacgaaaggactcac
gacccgttgctgtcgaacctatcactgctggttgaaacagcagttaggcttaggagagat
ggacatcgggttatcctagtctcctcgggggctattgggatcgggcttaggaggttagat
attgagaaaaggcctaaacatctttctgctgcgcaggctattgcggcggtcggccaatgc
agattgattgcgctttgggacgcgctgtttacccagcttcagcagccggttgcacaggtt
ctattgacgaggaatgatattgctgataggactcaatacctcaatgcttcgaacaccttt
gccgagttgctgagcatgggtatcattcccattgtcaatgagaacgatactctggctgtc
aatgaaatcaaattcggcgataacgatacgttgtcggcaattactgctggcatggtaaat
gcggattatctattccttatgacggacgtggattgtttgtacacggataatccaaggacc
cacccgaatgcgcagcctattgaggttgtagaggacatttcgactcttaaagttgacgta
tccagtactggctcgacactaggcaccggcggcatggccactaaactcacagcggcccgc
ctagctacctccgccggcgtaaccacaataatcacccggtcctcaatccccagcaacatc
ttccacatagtcgcgtacatccaatccctcaaagaagccgatcccaacacacaaccgcaa
acccccaccataccgccgtcgcaccctcttcacacccgcttcctggctaaacctcgcgct
ctccgcgaccgctatttctggatcctccacgggcttgccccacacgggactgtatacatc
gacgagggcgcgtatggtgctcttactcgcagggacaaagccggcttgctcccggtcggg
gtagtggatgttgcagggacgttcgcgcagcaggaggctgttaatttggctgttgttcag
aggatcgtcggcggtgggtacgtcattaaggggccggaggtgggaaaggcgttggtgaat
tactcttccactgagattgccagaattatggggcagcagagttctaagatccaggaacta
ttggggtatgctggtatgtatttccatcttctttcttctccttttattcttccacgttgg
tag

DBGET integrated database retrieval system