KEGG   Tuber melanosporum: GSTUM_00000551001Help
Entry
GSTUM_00000551001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
tml  Tuber melanosporum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 351 aa AA seqDB search
MSRHNSSSRKISFNVSDQYEIQDVVGEGAYGVVCSALHKPSGQKVAIKKITPFDHSMFCL
RTLREMKLLRYFNHENIISILDIQKPRNYETFTEVYLIQELMETDMHRVIRTQDLSDDHC
QYFIYQTLRALKAMHSANVLHRDLKPSNLLLNANCDLKVCDFGLARSAASTEDNSGFMTE
YVATRWYRAPEIMLTFKEYTKAIDVWSVGCILAEMLSGKPLFPGKDYHHQLTLILDVLGT
PTMEDYYGIKSRRAREYIRSLPFKKRIPFSAMFPKTSASALDLLEKLLAFNPAKRITVED
ALKHPYLEPYHDPEDEPTAPPIPDEFFDFDRRKDELSKEQLKMLIFEEIMR
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtctaggcataattcttcttcaaggaaaatttccttcaatgtcagcgaccagtatgag
atccaggatgttgtcggcgaaggggcttacggagttgtgtgttcggctcttcacaaaccc
tcgggccaaaaggttgcaattaagaagattactccgttcgatcacagtatgttctgcttg
aggacgcttcgcgagatgaagttgttgagatacttcaatcatgaaaatattatcagtatt
ctggatattcagaagccaaggaactatgagacctttaccgaagtctatctcatacaggag
cttatggaaactgatatgcatcgtgtgattcgcacgcaagatctttcggatgatcattgc
cagtactttatttaccagaccctacgtgctctgaaagccatgcattcggccaatgttttg
cacagggatctcaaaccttcgaatttgttgcttaacgcaaactgcgatttgaaggtttgt
gattttgggcttgctcgatctgccgccagcactgaagacaactctggttttatgactgaa
tacgttgctacaagatggtacagagctccagagataatgttgaccttcaaggaatacacc
aaggctattgatgtttggagtgtgggttgtattttagcggaaatgctgagtggaaaacct
ctcttcccaggaaaagattatcatcatcaactcactttgattttggatgttcttggaacg
cctaccatggaggattactacggaatcaaatctcgtcgtgcgcgtgaatacattcgctca
cttccattcaagaaaagaattccgttctctgccatgttcccgaagacatccgcatcggcg
ctggatcttttagagaagctattggcatttaaccctgcgaaaagaattactgtcgaagat
gctttaaagcacccttaccttgagccttaccatgaccctgaggatgaacccaccgcaccg
ccaattcccgatgagttctttgactttgatagaagaaaggatgaactgagcaaagagcaa
ctaaagatgcttatctttgaggagattatgcggtga

DBGET integrated database retrieval system