KEGG   Tuber melanosporum: GSTUM_00000660001Help
Entry
GSTUM_00000660001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
tml  Tuber melanosporum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GSTUM_00000660001
Enzymes [BR:tml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     GSTUM_00000660001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 605 aa AA seqDB search
MDSAPVFTALCALSSIIVRVGSYVFLRWMPGHVFPTAIFTAYGIYASLFAILYLGKPSYE
VVASSSEINILPADHDAKTASRRAATGGRATRDTRKPTAIEATETTIYRRRQPHPLKHLL
WGTPSVSGKLSLVTFAINTLLAAATWDLTFRTTYFYPSKNLSFARIGHVGPDSARVLLRE
PDSTRYPLSVWYSHGEDPTIDLHLVDTIPSLSEETDFTGTLAIHHLTPETKYRWYTSSNY
SGTFTTAPRQNEAPKGGRFTFLTTSCIKANFPYDPTRHPLAVKGFRDLSGWVEKLEARFM
LFLGDFIYIDVPRRPGLDKESYRQQYRQIYASPDWPSVGANLPWIHVIDDHEIANDWSSN
TTGVYPAAIDPFNIYQHSVNPPPVRPAGDPYYTFDYGSAASFFMLDTRTYRSPVHSPDGP
EKTMLGARQKADLLHWLSQGSGWKIIASSVPFTKNWRVNGRDTWAGYLYERQELLQQMWR
IGGGRVVILSGDRHEFAATAFPPPPDSGYSIASTVHEFSCSPLNQFFVPIRTYKQLDNED
LLIKYVPDGNRKFGAITVDTTNEEQGVLKYRLVVDGSEKWSWVLTAPRVVEERLHKEKER
GKWWS
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atggactcggcaccggttttcacggccctgtgcgccctaagctctatcattgttcgcgtt
gggagttatgtgttcttgcgatggatgcccggacatgttttccccacggcaatattcacc
gcgtacgggatttatgcgtctcttttcgctatcttgtatttgggcaagccgtcgtacgaa
gtggtagctagttcctccgaaatcaacattttgccggccgaccacgatgccaaaacggca
tcaagacgagcagcaacgggcggaagagcgaccagagatacaagaaagccaactgcaatc
gaggctactgaaacaaccatctaccgaaggcgccagccccatcctctcaagcacctcctc
tggggcaccccctccgtttccgggaagctaagtctagtaacgtttgcgataaatacgctg
cttgctgccgcaacatgggatctaacttttcgaacaacatacttctatcctagcaaaaat
ctcagttttgctcgcatcggtcatgtcggtcctgattccgcgagagtcctgttgcgagaa
ccagactctacccgctacccactttcagtatggtattcgcacggcgaagaccctacgatt
gacttgcatctcgttgacacgatcccctccctgtctgaagaaacggatttcacggggacg
ttagcaattcatcacttaacgccggagacgaagtatcggtggtatactagctcgaattat
tctgggactttcaccacggctccgcgacaaaacgaggcaccgaaggggggcaggtttact
tttttgacgacgagttgcatcaaggcgaatttcccgtacgatcctacaaggcatccgtta
gcggtgaagggttttagagatttgagcgggtgggtggaaaagttggaggcgaggtttatg
ttgtttttgggggacttcatttatatcgatgtgccgaggaggccagggcttgacaaggag
agctataggcaacaataccgccagatctacgcctccccggactggccttcggtaggggct
aacctcccatggattcacgtaattgacgaccacgaaatcgccaacgactggtcttcaaat
actacgggcgtttaccccgcggcgatagatcccttcaacatctaccagcactctgtcaac
ccacctcctgtccgtccggccggtgacccctactacaccttcgactacggttccgcggcc
agcttcttcatgcttgacacacgcacctaccgctcccccgtccactcccctgatggcccg
gaaaagaccatgctcggggcacgtcaaaaggccgacctcctgcactggctgtctcaaggt
agcggttggaagataatcgctagcagcgtcccctttaccaaaaactggcgtgtgaacggc
cgagacacatgggctggatatctttacgagcgccaggaactccttcagcaaatgtggaga
atcggcggtgggcgagtggtcatcctttccggtgaccgccacgaattcgccgcgacggct
ttccctccaccaccagattctgggtactcaattgctagcactgtccacgaattctcatgc
tccccgttgaatcagttctttgtgccgattaggacatataagcagctcgacaatgaggat
ctgctgatcaagtatgttccagatgggaatagaaagtttggagccattacagttgataca
acgaacgaagagcagggcgtgctaaagtacaggcttgtggttgacgggagtgagaagtgg
agttgggtgcttaccgcacctagggttgtggaggagaggttgcacaaggagaaggagaga
gggaagtggtggagctga

DBGET integrated database retrieval system