KEGG   Tuber melanosporum: GSTUM_00000952001Help
Entry
GSTUM_00000952001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
tml  Tuber melanosporum
Brite
Enzymes [BR:tml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     GSTUM_00000952001
Peptidases [BR:tml01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   GSTUM_00000952001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 1091 aa AA seqDB search
KCAPRFWADLIAYNPLRKERNFLPDNPPHFDPQLHASYEPNHKHVLDVIAEKSCYVKNEI
ISIDQAYKIATICQTCRMHIDIEAEFTKPVEFNAEVALCPNKGSRNQYRYNLLHHFRYES
KISSPVDTSRYDKRSRKRWVDKRVFSCSSTNCPLVVTVTTQPAMIRPDLMELLLSEKTRE
ARVKEAARINPNVIPVDAAPQTRYQVLETLCTYIKNHKGGDQRSIFAENKRYLCNLGECE
EVMRLAHFTRSPDPDTNAWIPSSSAELGDPGSQAQRDLCGLLEEVMILMDDEKHKGDAPA
KSARVRQKTERAELVAKWLLGFHKYDTAIGWQFDLTAPEHPHYAGLGAVADMSDDLINWA
YERQRACDPINAPYYFECFESIAKGRKSENLQFEVARLRSEGQFSTSDLESSYKSLGVDP
VTSDDDLIIGVFKSRLADAPRQEGPMREDMRIIGTARRSEKILSFAKLAVGDIADAYKWL
RVLESSEDQYILSAYKVRIEDNPDDEITARNALKLIAENRQSNVLYCFLEGNLYETPLEI
GAAYSRLGIDDYSLSEDLIVNVFELRQQDAPSQTRDLRAALRSIGQNRNSARIQSYLQTG
NADGISKGSAEWPVGLENIGNTCYLNSLLQFYFTIKPLRDMILNIDQFQEEEINNEGQEI
CSPSSHLIPEPHNIPGIFLLKMRRRRSDDCLQIGPMTKKIFLHSKKSPQAASGVAANKAR
PTYGPPTPPPDMPDRPPPVPPRPTKQDPKPDTNFMFGRQQDVTECIGNVMFQVEAAIKPE
SVDGNGEQIDLVKKLFYGRTKQTLSFPNSAETRTKEELFSHLLVDVAEGDRDIYSALDSS
FDIEQVDLEGREAKRFLSISHLPPILQIQVQRVQYDRAKASAYKSNSHLKFPDTIYLDRY
METEDSDLKAKREESWVWKEELKALEQRLAELTKTPAGIRVPEALEYTHQWLSELKSDDE
IEVQPALLRELEQRAISMRREGESIEARIQALQSRIEQQFTDSCNQGYRIHSVFIHRGSA
SFGHYWIYIYDFQRKLFRKYNDSYVTEVADPQEVFTHGDINPPTPYFLVFVKEDESLDIM
EAVQRQIVTTT
NT seq 3276 nt NT seq  +upstreamnt  +downstreamnt
aaatgtgctcccagattttgggccgacttgattgcctacaatcctctaaggaaagaacgt
aatttcctgccagacaatccccctcatttcgatccccaactccatgcgtcatacgaaccg
aatcacaaacatgtactagatgttatagcagagaaaagctgctacgtcaagaacgagata
atctccatcgaccaggcatacaaaattgcaactatttgtcaaacatgtcgaatgcatatc
gacattgaagctgaatttacgaagcctgtcgagtttaatgccgaagttgccctctgcccg
aataagggcagccgaaatcaatatcggtataacctactacaccacttccgttatgagtcc
aaaatatcatcaccggtggatacctctcgctacgacaagaggtctcggaagagatgggtg
gacaagagggttttctcatgctcttcgactaattgccccctagttgttactgttaccacg
cagcctgcgatgataagacccgacctgatggaattgctactttcggagaaaacccgtgag
gctagagttaaagaggcggcgaggataaatccgaatgttattcctgtggacgcggctcca
caaactcgataccaagttcttgagactctctgtacctatatcaagaaccacaaaggtggt
gaccaacggtcaatctttgctgaaaacaagcggtacctatgtaatctaggagaatgcgag
gaggtcatgcggttagcgcattttaccaggtctcccgatcctgacacgaacgcttggata
ccgtcttcctctgccgagctgggcgatcccggttcacaagcgcaacgggatctttgcggg
ttgctagaggaagttatgatactaatggatgatgagaaacacaaaggggatgctccggcg
aaatctgcccgtgttcgtcagaaaaccgagagagcagagcttgtggctaaatggctcctc
ggatttcataaatatgataccgcaattggctggcagtttgaccttacagctccagaacat
ccccactatgccggccttggtgcggttgcggatatgtcagacgatcttataaactgggca
tatgagcgccaacgggcgtgcgatcctattaatgctccatattattttgagtgctttgag
agtatagctaagggtaggaagagcgagaatctccaattcgaagttgcccgcctacgttcc
gaggggcaattttctacgtctgacctggagagcagctataagtcgctcggtgtggatccc
gttacatcggatgatgatttaattatcggtgtgtttaagagccgattggccgacgctcct
cgccaggaaggaccaatgagagaggacatgaggattattggaaccgctaggaggagcgag
aagatactttcgtttgcaaaacttgctgtcggagatattgcagatgcctacaaatggctt
cgcgtcttggaaagcagcgaggatcaatatatcctctcggcatacaaagtccggatcgaa
gacaatcccgatgacgaaatcactgccaggaatgctttgaaattgatcgcagaaaatcgc
caaagcaatgttttgtattgcttcctcgagggaaacctctacgagactcccctggagata
ggcgctgcatacagtcgcttggggatcgacgattactctcttagtgaggatctgatagtc
aatgttttcgagttgagacaacaagacgctcccagccaaacgcgagacctcagggcggcg
cttagaagtattggccaaaatcgaaatagcgccaggattcaatcatacctccagacaggg
aatgctgatggaatttcaaagggttccgcggagtggcctgttgggcttgagaacattgga
aacacttgctatctgaatagtttgctgcagttttacttcactataaagccactacgcgac
atgattctcaatatcgatcaattccaagaggaggaaatcaataatgagggccaagaaatt
tgttcgccatcttcgcaccttattccagaacctcataacatcccaggcatcttccttcta
aagatgaggaggaggaggagcgacgattgtcttcaaatcgggccgatgacaaagaaaatc
ttcctccactcaaagaaatcaccgcaggcggctagtggggttgctgcaaacaaggctcgc
ccaacatatggcccaccaaccccacccccggatatgccggatcgaccacctccagttccc
ccacgcccaaccaaacaagatccaaaaccagacacaaattttatgttcgggcgccaacag
gatgtcacagaatgtattggtaatgttatgttccaggtggaagctgctattaaaccggaa
tctgttgatgggaatggagaacagatagatttagtgaagaaactgttttacggaaggaca
aagcaaacactctctttcccgaattccgccgagaccaggactaaagaggaattgttttct
cacttgctggtcgatgttgcagaaggtgaccgagacatctactcagctcttgacagcagc
tttgatatcgagcaggttgatctggaaggacgagaagccaagcgttttctgtctatcagc
catttgccacccatcttgcagatacaggttcagagagttcagtatgatcgggctaaggct
tctgcatacaagtcaaattcgcatttgaaattcccagacacgatatatcttgatcgatac
atggaaaccgaagactctgatcttaaggcaaagcgggaggagtcctgggtatggaaagag
gagctaaaggcactggaacaaagattggcggagctaacgaagactccagctgggatacgt
gttcccgaggcactcgaatacactcaccagtggctttccgagctcaaatctgatgatgag
atagaggtccagccagctctccttagggagctcgaacaaagagccatatccatgcgccgg
gagggtgaatcgattgaagcccggattcaagcgcttcagtctcgtattgagcaacaattt
acagactcctgcaatcagggctatcgcatccactcggttttcatacacagaggatccgca
agcttcggccactactggatctacatctacgatttccagagaaaactctttcgcaagtat
aatgacagttatgtgactgaagtggcggatccccaagaggtctttactcatggggatata
aacccccctacgccttatttccttgtcttcgtaaaggaggacgaatccctagatatcatg
gaagctgtccagagacaaattgtcaccaccacctaa

DBGET integrated database retrieval system