KEGG   Tuber melanosporum: GSTUM_00001086001Help
Entry
GSTUM_00001086001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
tml  Tuber melanosporum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tml00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 279 aa AA seqDB search
MPPPINTDQLTNQIDHRVFRIRENGGPANDIVPTESTTNQRRRTSIALALGDAHPRAELE
ASRRQFVDYDGLSWPSSGTRERLEATPAEAEARLEKLSGAIRTILECIGEDPDREGLLET
PSRYAKAMLYFTKGYEENLKLIINNAVFREDHDEMVIVKDIEIYSMCEHHLVPFTGKMHI
GYIPRGKVLGLSKFARIAEMFARRLQLQERLTKQVAVAIEEILEPLGVAVVMESAHLCMV
MRGIEKTTATTTTSSMLGCFRKRTRTREEFLRLALNSTR
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgcccccaccaataaacacggaccagctaaccaaccaaatcgatcaccgtgtgttccgg
atccgtgagaatggaggccccgcaaacgatatcgtgccgaccgaatctaccactaatcag
cgaaggcggacgtccattgctttggctcttggcgatgcgcacccccgcgcagaactggag
gcttcgagacggcagttcgttgattatgacggattgtcgtggccgagttcgggcacgagg
gaaaggttagaagctacgccagccgaggcggaagctaggcttgagaagttgtctggggca
attaggacgatactagaatgtattggcgaagaccccgaccgcgagggtctcctagagaca
ccctcccgatacgcaaaagcgatgctatacttcacgaaaggttacgaggagaacctcaag
ctaatcatcaataacgccgttttccgggaagaccacgacgaaatggtaatagtcaaagac
attgaaatctactccatgtgcgaacaccacctggtccctttcaccgggaagatgcacatc
ggctacattccacggggcaaagttctaggcctctccaagttcgctcgtatagcggagatg
tttgcccgacgcttgcagctacaagagcgcctaacgaagcaggttgctgtggcgatcgag
gagattttggaacccctgggagtcgcggtggtcatggagagtgcacacttgtgcatggtc
atgaggggcatagagaagacgacggctactacaaccactagttctatgcttgggtgcttt
aggaagaggactaggaccagggaggaatttctgagactggcgttgaatagtacgagatag

DBGET integrated database retrieval system