KEGG   Tuber melanosporum: GSTUM_00001154001Help
Entry
GSTUM_00001154001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
tml  Tuber melanosporum
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    GSTUM_00001154001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 108 aa AA seqDB search
MGFQEGDNAKGANLFKTRCAQCHTLEAGGANKVGPNLHGLFGRQSGQVEGFSYTDANKQK
GVVWTEETLFDYLENPKKYIPGTKMAFGGLKKEKDRNDLITHLRKNTK
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgggtttccaagaaggcgataatgctaagggtgcgaaccttttcaagacccgctgcgct
caatgccacaccctcgaggccggcggcgcgaataaggttggtcctaacttgcacggtctg
tttggacgtcagtccggacaggtagagggtttctcctataccgatgcgaacaagcagaag
ggcgttgtctggaccgaggagaccttgttcgattacctcgagaacccgaagaagtacatt
cccggaaccaagatggctttcggtgggttgaagaaggagaaggacaggaatgacttgatc
acccacctgcgcaaaaatactaaataa

DBGET integrated database retrieval system