KEGG   Tuber melanosporum: GSTUM_00001154001Help
Entry
GSTUM_00001154001 CDS       T01282                                 

Definition
(RefSeq) hypothetical protein
  KO
K08738  cytochrome c
Organism
tml  Tuber melanosporum
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 9183074
NCBI-ProteinID: XP_002838551
INRA: GSTUM_00001154001
UniProt: D5GDZ9
AA seq 108 aa AA seqDB search
MGFQEGDNAKGANLFKTRCAQCHTLEAGGANKVGPNLHGLFGRQSGQVEGFSYTDANKQK
GVVWTEETLFDYLENPKKYIPGTKMAFGGLKKEKDRNDLITHLRKNTK
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgggtttccaagaaggcgataatgctaagggtgcgaaccttttcaagacccgctgcgct
caatgccacaccctcgaggccggcggcgcgaataaggttggtcctaacttgcacggtctg
tttggacgtcagtccggacaggtagagggtttctcctataccgatgcgaacaagcagaag
ggcgttgtctggaccgaggagaccttgttcgattacctcgagaacccgaagaagtacatt
cccggaaccaagatggctttcggtgggttgaagaaggagaaggacaggaatgacttgatc
acccacctgcgcaaaaatactaaataa

DBGET integrated database retrieval system