KEGG   Tuber melanosporum: GSTUM_00001435001Help
Entry
GSTUM_00001435001 CDS       T01282                                 

Definition
(RefSeq) hypothetical protein
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tml  Tuber melanosporum
Pathway
tml00010  Glycolysis / Gluconeogenesis
tml00051  Fructose and mannose metabolism
tml00562  Inositol phosphate metabolism
tml01100  Metabolic pathways
tml01110  Biosynthesis of secondary metabolites
tml01130  Biosynthesis of antibiotics
tml01200  Carbon metabolism
tml01230  Biosynthesis of amino acids
Module
tml_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tml_M00002  Glycolysis, core module involving three-carbon compounds
tml_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GSTUM_00001435001
   00051 Fructose and mannose metabolism
    GSTUM_00001435001
   00562 Inositol phosphate metabolism
    GSTUM_00001435001
Enzymes [BR:tml01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     GSTUM_00001435001
Exosome [BR:tml04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   GSTUM_00001435001
  Exosomal proteins of bladder cancer cells
   GSTUM_00001435001
  Exosomal proteins of melanoma cells
   GSTUM_00001435001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 9187528
NCBI-ProteinID: XP_002835693
INRA: GSTUM_00001435001
UniProt: D5G5Q7
AA seq 274 aa AA seqDB search
MSCFIVSFLYSSTISHNHDTTTIFAINQNNFWAFNFVLTIRQKWSASFFIIEGLNNASLD
PNVDVVISPPAIYLLLAKEIASNGVQVAAQNVYDKGNGAYTGEISPEQLKDAGINWVIIG
HSERRALLGESDRFVASKTRAALAGGLSVILCIGESLEEREAGTTIDVVTRQLQAVADEV
SDWSNIVIAYEPVWAIGTGKVATTEQAQEVHAAIRDWLKKTVSDKAAEGTRILYGGSVTD
KNSKELATQPDVDGFLVGGASLKPAFVDIINSAA
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgagctgttttatagtgtcatttctttactcatccaccatctctcataaccacgacaca
actaccatctttgccatcaaccagaataacttttgggctttcaatttcgttttaacaatt
cggcaaaaatggtccgcaagttttttcatcatcgaggggctcaacaatgcttctctggac
cccaatgttgatgttgtaatttccccaccagcaatctatctcctccttgccaaagagatt
gccagcaacggtgtccaggtcgctgcccagaacgtttatgacaaaggaaatggtgcgtac
actggcgaaattagcccagaacaattgaaggatgctggtatcaactgggtcataatcgga
cacagtgagcgtagagcccttctcggggagagcgataggtttgtcgcttcaaagactagg
gcagcgcttgccgggggtttgagcgtgattttgtgcattggggagtcgcttgaggagcgc
gaggctggaacaactatcgatgttgtcacaagacaacttcaggctgttgctgatgaggtc
agcgactggtctaacattgtcattgcctacgagcccgtttgggctattggtactggaaag
gtggctactactgaacaagcccaagaggtccacgccgccatccgtgactggttgaagaag
accgtctctgataaggcagccgaggggaccagaatcctttatgggggaagtgtcactgac
aagaattccaaggagcttgctacccagcctgatgttgacggtttcttggttggtggtgca
agtttgaagcctgccttcgtggacatcatcaactctgctgcttag

DBGET integrated database retrieval system