KEGG   Tuber melanosporum: GSTUM_00001435001Help
Entry
GSTUM_00001435001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tml  Tuber melanosporum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:tml01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tml01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tml00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tml00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:tml00562]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 274 aa AA seqDB search
MSCFIVSFLYSSTISHNHDTTTIFAINQNNFWAFNFVLTIRQKWSASFFIIEGLNNASLD
PNVDVVISPPAIYLLLAKEIASNGVQVAAQNVYDKGNGAYTGEISPEQLKDAGINWVIIG
HSERRALLGESDRFVASKTRAALAGGLSVILCIGESLEEREAGTTIDVVTRQLQAVADEV
SDWSNIVIAYEPVWAIGTGKVATTEQAQEVHAAIRDWLKKTVSDKAAEGTRILYGGSVTD
KNSKELATQPDVDGFLVGGASLKPAFVDIINSAA
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgagctgttttatagtgtcatttctttactcatccaccatctctcataaccacgacaca
actaccatctttgccatcaaccagaataacttttgggctttcaatttcgttttaacaatt
cggcaaaaatggtccgcaagttttttcatcatcgaggggctcaacaatgcttctctggac
cccaatgttgatgttgtaatttccccaccagcaatctatctcctccttgccaaagagatt
gccagcaacggtgtccaggtcgctgcccagaacgtttatgacaaaggaaatggtgcgtac
actggcgaaattagcccagaacaattgaaggatgctggtatcaactgggtcataatcgga
cacagtgagcgtagagcccttctcggggagagcgataggtttgtcgcttcaaagactagg
gcagcgcttgccgggggtttgagcgtgattttgtgcattggggagtcgcttgaggagcgc
gaggctggaacaactatcgatgttgtcacaagacaacttcaggctgttgctgatgaggtc
agcgactggtctaacattgtcattgcctacgagcccgtttgggctattggtactggaaag
gtggctactactgaacaagcccaagaggtccacgccgccatccgtgactggttgaagaag
accgtctctgataaggcagccgaggggaccagaatcctttatgggggaagtgtcactgac
aagaattccaaggagcttgctacccagcctgatgttgacggtttcttggttggtggtgca
agtttgaagcctgccttcgtggacatcatcaactctgctgcttag

DBGET integrated database retrieval system