KEGG   Tuber melanosporum: GSTUM_00001691001Help
Entry
GSTUM_00001691001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
tml  Tuber melanosporum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    GSTUM_00001691001
Enzymes [BR:tml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     GSTUM_00001691001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 323 aa AA seqDB search
MAPIPRTILVIGSLNIDLTTRTRRLPNPGETIAAQTFSTAPGGKGANQAVACCRLARASS
DAPLDNILVKMVGAVGDDEFGGRLKDALRQNRIDVEGVVVKGGVSSGVAVIIVDEDTAEN
RILYTAGANEALTAQDFPENFFSSFTPLPSFLVLQLETPLQTVLHLLTLASNAGVETVLN
PAPARHIPLQFYSKIDHLILNESEAAYLTGEEVTFLDDDDGVKLTIDRFLERGVKRSVVI
TMGARGCYFKSPDRQEGWIRPEVRAQDVVDTTGAGDAFVGAFAVARVEGNDVGQSLNFAT
RAASIKVQNMGAQAGIPWRGEVQ
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggctccgattcccaggactattctcgtcatcggttcattaaacatcgatctgactacc
agaactcgtcgccttcctaaccccggcgaaactatagctgcccaaactttctcaactgca
ccaggtgggaaaggggcaaaccaagctgtcgcatgttgtcgcctggctcgagcatcctcc
gatgcaccactagacaacattttggtcaagatggtcggtgctgtcggagatgatgagttc
gggggccgtctcaaggacgccttaaggcagaatcggatcgacgttgaaggagtagttgtc
aagggaggagtttctagtggcgtcgccgtgatcatagttgatgaagatactgccgagaac
cgcatcctttacacggctggcgcgaacgaagctctcactgcccaagattttccggaaaac
ttcttctcgagctttacccctctcccttcttttcttgtcctgcagctcgagaccccgctc
caaacagtcctacacctcctaaccctcgcctcaaacgctggtgtcgaaactgttttaaat
cccgctccggccaggcacatccccctccagttctattccaaaatcgatcatctaatcctc
aatgaatctgaagccgcgtacctcactggggaggaagttaccttcctggacgacgatgac
ggggtcaagttaacgatcgaccgcttccttgagcgtggcgttaagcggagcgtggttatc
accatgggcgcccgcgggtgctatttcaagagcccggatcgccaggaaggttggattagg
cccgaggttcgggcacaggacgtggtggacaccaccggtgctggggatgcgtttgtcggc
gcatttgcggttgcccgtgttgaagggaatgacgttggacaatccctgaatttcgcgacg
agggcggcgtcgatcaaagtccagaatatgggggctcaggcgggcatcccgtggaggggc
gaggtgcaatag

DBGET integrated database retrieval system