KEGG   Tuber melanosporum: GSTUM_00001753001Help
Entry
GSTUM_00001753001 CDS       T01282                                 

Definition
(RefSeq) hypothetical protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tml  Tuber melanosporum
Pathway
tml00010  Glycolysis / Gluconeogenesis
tml00020  Citrate cycle (TCA cycle)
tml00620  Pyruvate metabolism
tml01100  Metabolic pathways
tml01110  Biosynthesis of secondary metabolites
tml01130  Biosynthesis of antibiotics
tml01200  Carbon metabolism
Module
tml_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GSTUM_00001753001
   00020 Citrate cycle (TCA cycle)
    GSTUM_00001753001
   00620 Pyruvate metabolism
    GSTUM_00001753001
Enzymes [BR:tml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GSTUM_00001753001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 9187659
NCBI-ProteinID: XP_002835823
INRA: GSTUM_00001753001
UniProt: D5G637
AA seq 414 aa AA seqDB search
MPALSPTMTSGNIGSWQMSVGDTIAPGDSLVEIETDKAQMDFEYQEDGVLAKILKPSGST
DVAVGNPIAVIVEDGTDISAFGDFTVESAEGGAGAPPPPEGESLDSPELPKSEEPASSGG
RLETVLERDGRIIASPLAKKIALEKGIALKGIKGTGEGGRITKYDVENYESTGISSASGM
PAVVSTDIPLTSMRKTIASRLQASKNTNPHYYVSASLSVSKLLKLRQALNTSAKGEYKLS
VNDFLIKAVANALLKVPTVNSSYREDEGVIRQFSTADISVAVATPVGLMTPIVKNADARG
LVSISNEVKSLSGRARDGKLKPEEYQGGTFTISNMGMNPAVERFTAIINPPQAGILAVGT
IKKVAVEGKDGGVEWDEQIVVTGSFDHRVVDGAVGGEFLRELKKLIESPLEMLL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgcccgctctgtcccctaccatgacttcggggaatattggctcatggcagatgagcgtt
ggtgataccattgctcctggtgattccttggttgagatcgagacggataaggctcagatg
gacttcgaataccaggaggatggcgtcctggctaagatcctgaagcccagtgggtctaca
gacgttgccgttggaaatccgattgctgtcatcgttgaagacgggacagatatatctgcc
tttggagactttaccgttgaaagtgctgaaggaggggccggggctcccccgccgcccgag
ggggaatctctggattctcccgaactccccaagtctgaggagccagcttctagcgggggc
agactagaaactgttttggagcgtgatggaagaatcattgcttcccctctcgccaagaag
attgcattggagaagggaatcgcgttgaaaggcattaaggggactggagaaggcggtcgc
attaccaaatatgatgtcgagaattacgaatcgactggaatttcctctgcgtccggcatg
cctgctgttgtaagcactgatattccgttgacatctatgcgcaagacaattgcatctcgt
ctccaggcttcgaagaacaccaaccctcactactacgtctcagcttctctctctgtgagc
aagcttctcaaactccgccaggctctcaacacctctgccaagggagaatacaagctttct
gttaatgacttcctaattaaggctgttgccaatgcattgctcaaggttcccactgtcaac
tcttcttatcgtgaggatgagggtgtcattcgccaattctccaccgccgacatttctgtt
gctgttgctaccccggttggcctgatgactcccattgtcaagaatgccgacgccagaggt
ttggtttcgatctctaacgaggtcaagtccctttctggaagagctagagatggaaagctt
aagcccgaggagtaccaagggggtacttttaccatctcaaacatgggaatgaatcccgct
gttgaaaggttcactgccatcatcaaccccccacaggctggaatcttggctgtcggaact
attaagaaggttgccgttgagggcaaagacggaggtgttgaatgggacgagcagattgtt
gttactggatccttcgatcacagggttgtagatggtgccgttggtggggaattccttaga
gaactcaagaagctcattgagagccccctagaaatgctcctatag

DBGET integrated database retrieval system