KEGG   Tuber melanosporum: GSTUM_00002161001Help
Entry
GSTUM_00002161001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
tml  Tuber melanosporum
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    GSTUM_00002161001
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    GSTUM_00002161001
Enzymes [BR:tml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     GSTUM_00002161001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 1024 aa AA seqDB search
MAKASPPRHRPTDLHIQPQCFNVQSNNILQAQLTASPSSSEPLSYRHSINSVPSLFSSPT
TPSPTLNNDFQAGMAFWSLKTWPTGRSKHISSSSDLAHSNLSPTITTPSTAPSSIHTTDP
PKTPTQPRSKTSLIRRVSNKLRRRASSSTPKDSEERSGPVLARLRSDSFNGGETGRLGIQ
KKDEPFEDEDHEQAIEGEEDGARTSTSVEASHPDESIGAIGVMIPDVLKDGTAMTRVTRK
KKTQRIFSLDPTATRVTWDATKQSSRFYIDDIKEIRLGADARNYREEFQVSSEVEDRWAT
IIYAEPETGKLKTLHVIAPTIETLELWTATLDIVMQYRTEMMAGLSMPGENFVDAHWRNY
MGSRGPAKAPDSNDEKLGFEDVERLCRRLHVNCSRQFLKDRFKQSDKDKSGFLNFVEFRE
FVRLLKQRDEIVDIWRDAVTDRKAGMSVDEFRTFLKEEQKVDIDSEPMYIDKIFRKFTRP
PSSQQQATRRERSTVRMSMDAFSDFLLSSSYNPPLLSAPLGNNFDRPLNEYYISSSHNTY
LLGRQVAGESSIEAYIRVLKRGCRCVEIDCWDGDDGRPIVTHGHTGTSDILFLDVITAIR
KYSFVTSNLPVILSLEVHCDLEQQVEMAKILRSVLGDALVTEPFMTNTLILPSPNVKGSS
RQDTLMSNNDFGSTEKRAGSTNNLPNSSPPLPKSGIPSETSSSTTLFCTSQIREIRKGSG
KEGSIREAQCSVPHASLPIWISSQLLEFRPNRILASRSPDGLQINEAMFASEEDRGGYVL
KPKELRGSRTSFDPPADANAATLTKNKKVTTFSVEIISAQQLPKPKDHKDKGIHPFVVVE
VFSADDKAKDKSVAEGGIGVDSSDAKGISGLGAPQKRRTKVVKDDGFHPLFREKMVFKVT
TKFEELIFVRFSVYSADDGDSSDRTLIATYTAKLLSLQQGYRHLPLYDLQGEQFLFSMIF
VKINVSSVSLADREPLMRESAMEAFKSTAKSVLQRGFSANGSSVRHLDSQKIGKTGGQEP
TTRV
NT seq 3075 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagcatcacctcctcgacaccgtccgacggaccttcacattcaacctcagtgt
tttaatgtccagtctaataatatactccaagctcagcttaccgccagtccttcctctagc
gaaccgctgtcctaccgacactcaataaattcagtgccatcgttgttttcttctcctacc
actccttctcccactctaaacaacgattttcaagcaggaatggctttctggtccctgaag
acatggcctaccggcagatcaaagcatatctcctcctcgtcggatctcgcccattccaat
ttatctcctaccataaccaccccctctactgcaccctcgagtattcatactaccgatcct
cccaaaacaccaactcaaccacgctcaaaaacaagcttaatcagaagagtttcgaataaa
ctacggaggagggcatcatcctccaccccaaaagattcagaggagcgaagtgggccagtt
cttgcgcggcttcgaagtgacagcttcaatggcggagaaaccgggcgtctcggcatacaa
aagaaggacgagcctttcgaggacgaagatcacgaacaagctattgagggagaagaagac
ggagcgagaacgagtactagtgtggaagcttcccacccagatgagtcaatcggggccatt
ggggtcatgatacccgatgtattgaaggatggaacggcaatgactagggttacgagaaag
aagaagacccaacgaattttttccctagatcccaccgccacccgagtaacctgggatgct
acgaagcaatcttccagattttatatcgacgatattaaggagattaggctgggagcggat
gcacgaaactatcgagaggaattccaggtttcatcggaggtggaggacagatgggccact
ataatatatgcggagccggagactgggaagctcaaaacacttcacgtcattgcgcctacc
attgaaacactggaactctggacagctacgttggatatagtaatgcagtacaggaccgaa
atgatggccggtttatcaatgcccggtgagaactttgttgacgctcattggagaaactat
atggggtcccggggtcccgcaaaagctcccgattcaaacgacgagaagctagggtttgaa
gatgtggaacggctgtgccgaaggctacatgtcaactgctcaagacagtttttgaaagac
aggtttaagcaatccgacaaggacaaatccggttttctgaattttgttgaatttcgtgaa
tttgttcggttactaaagcaaagggatgaaattgtcgatatttggagagatgctgttacg
gacagaaaggctgggatgtctgttgacgaatttcgaaccttcctcaaagaagagcagaag
gtagacatcgattctgagccaatgtatattgacaaaatctttcgaaagttcacccggccg
ccttcttctcaacagcaggccacacggagggaaaggtcaaccgtccggatgtcaatggac
gcattctctgattttcttctctcttcatcctataatcccccactgctctccgcgccactg
ggtaacaacttcgatcgaccactgaatgaatactatatatctagttcacacaacacttat
ctcttaggtaggcaggtcgccggcgagtcatcgatcgaagcttatatacgcgtcctcaaa
cgtggctgccgatgtgttgagatcgactgctgggatggcgatgatggtagaccaatcgtt
acccatggtcacaccggcacctccgatattctatttttggacgttataacggccatcaga
aagtattccttcgttacttcaaacctccccgtcatactctcattagaagtccactgcgat
ttggaacaacaggttgagatggcgaaaattcttcgtagcgtcctaggtgacgcacttgtt
acagagcctttcatgacaaacacgttaattctaccaagcccaaacgtcaaaggcagctct
aggcaagacaccttaatgtcaaacaacgacttcggctcaacggaaaaacgggccgggagc
accaataatctcccgaactcttcacccccgctccctaagagcggcataccgagcgagacc
agcagctccacaacccttttttgcacttcacaaattcgagaaattcgcaaaggatccgga
aaagaaggttcaattagagaagcacaatgttcggtacctcatgcgagtttacccatctgg
atttcgagtcaactcctcgaatttcgacccaatcggattctggcgtcgaggagtccagat
ggcttgcagatcaacgaggccatgtttgcttctgaagaagatcgtggtggatatgttctg
aaaccaaaagaactccggggttccaggacttctttcgacccacctgccgatgcaaatgcc
gcaacactaacaaagaacaagaaagttacaaccttttctgtcgaaataatttccgcgcag
caattgccaaagcctaaagatcacaaggacaaaggcattcatccattcgtggtagtagaa
gttttttccgcggatgacaaggcgaaggataaatcggtagccgaaggcggaatcggtgtt
gattcaagcgacgccaaaggtatcagcgggctcggagctccccaaaagaggcgaacaaag
gtggtgaaagatgacggctttcaccccttgttcagagagaaaatggtttttaaagtcaca
accaaattcgaagagttgatatttgtgaggttctcagtgtacagtgcggatgacggtgat
tcgagtgatcgaacactcatcgctacctacactgcgaagctcctctctcttcagcaaggc
taccgacacctaccgctttatgatctccaaggggagcagtttcttttttcaatgatattt
gtcaagatcaatgtcagctcggtctcgctggccgaccgagagccactcatgcgggaatca
gcaatggaagcgttcaagtctacagcaaagtcagtcctacagagaggcttctccgctaat
gggagctcggtgagacacttggatagccaaaagataggtaaaactggtggccaggagcca
acaacacgggtatag

DBGET integrated database retrieval system