KEGG   Tuber melanosporum: GSTUM_00002314001Help
Entry
GSTUM_00002314001 CDS       T01282                                 

Definition
(RefSeq) hypothetical protein
  KO
K00898  pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
tml  Tuber melanosporum
Brite
Enzymes [BR:tml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     GSTUM_00002314001
Protein kinases [BR:tml01001]
 Serine/threonine kinases: Other
  PDHK family [OT]
   GSTUM_00002314001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BCDHK_Adom3 HATPase_c HATPase_c_3 BRCA-2_helical
Motif
Other DBs
NCBI-GeneID: 9185255
NCBI-ProteinID: XP_002836132
INRA: GSTUM_00002314001
UniProt: D5G730
AA seq 397 aa AA seqDB search
MWKPTQALMDTITHYSQFPATGVSLRQMVQFGRNPSAGTLFKASQFLMRCPPFRKLPIGI
CSHLRRSLAFRNPSFPEKYVKKTGLANPDIEPAAYRSPPWLIATNTTGSVRKAQRRYYAT
VDDGVRWPPEIVDYNKRFTKILQNIKHRHDPVVTTMAMGINEYKRKRQRMQIDNSIQSFL
DRFYMSRIGIRMLIGQHVALNSAPEQEDYVGIICTKTNVRELAQEAIENARFVCEDYYGL
FDAPKVQLVCKSDLHFMYVPGHLSHMLFETLKNSLRAVVETHGSDAEEFPPVKLIVTEGK
EDITIKISDEGGGVPRSAIPLVWTYMYTTVESTPPIDPDFNKSDFKAPMAGFGYGLPISR
LYARYFGGDLKLISMEGYGTDVYLHLNRLSSSSEPLQ
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaaccaacgcaggccttgatggacaccatcactcattatagccagtttcctgct
actggtgtgagtttgcgacagatggtgcaattcggacggaatccatccgctggaacacta
tttaaggcctcacaatttttgatgagatgccctccattcagaaagttgccaattggtata
tgcagtcatttgaggagatcactagccttccgaaacccgtcctttcccgagaaatacgtg
aaaaaaaccggtctcgccaaccctgatatcgaacccgcagcttaccgaagtccaccgtgg
ctaattgccaccaatactactggcagtgtaaggaaggcgcaaaggcgatactatgctaca
gttgacgacggagtgaggtggccgccagaaattgtcgactataataagcgtttcactaaa
attttacaaaacattaagcatcgccatgatcccgttgttacaaccatggcgatgggaatc
aacgagtacaagcggaaacggcaacggatgcagatcgacaactcaatccaatcattcctg
gaccgtttttacatgtctcggatagggattcgcatgctcattggccagcacgtcgcactc
aattccgctcctgagcaagaggactacgtgggaattatttgcacaaaaaccaatgttcgc
gaactcgcacaggaggctatcgagaatgcccgctttgtctgcgaggattattacggactg
tttgacgctcccaaagtgcagttggtttgcaagtctgatctgcactttatgtacgtcccg
ggacatctgagtcacatgctattcgaaactttgaaaaactcactcagagccgttgtggag
acacacggaagtgacgctgaggaattcccgccggtcaaactgattgttacggaaggcaag
gaggacatcactatcaaaatatccgatgaaggaggtggggtcccgaggagcgccataccc
ttggtctggacatatatgtacacaaccgtagaatcgaccccgccgatcgacccagacttc
aacaagagcgacttcaaggcacccatggctggtttcggctatggattaccaatatcaagg
ttgtatgcaagatactttggtggagatctgaagttaataagcatggaagggtacggaaca
gacgtatatctccacctaaacagactaagcagttcctcagaacccctccagtaa

DBGET integrated database retrieval system