KEGG   Tuber melanosporum: GSTUM_00002338001Help
Entry
GSTUM_00002338001 CDS       T01282                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tml  Tuber melanosporum
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GSTUM_00002338001
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GSTUM_00002338001
   00620 Pyruvate metabolism
    GSTUM_00002338001
   00640 Propanoate metabolism
    GSTUM_00002338001
  Energy metabolism
   00680 Methane metabolism
    GSTUM_00002338001
Enzymes [BR:tml01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     GSTUM_00002338001
Lipid biosynthesis proteins [BR:tml01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   GSTUM_00002338001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 606 aa AA seqDB search
MSEAEVSVVSEAHNVETYQVPRKYYEKHPAKPHLTLEEYKAQYRESIENPDKFWGEKARE
LLHWDIPFQTVRNGSFQHGDISWFLEGRLNACYNCVDRHAFKDPERPAIIYEADEPSEGR
VITYSELLREVCKLAFVLRQMGVRKGDTVAIYMPMIPEALVAFLAIVRIGAVHSVVFAGF
SAESLRDRVLDARSKVVITTDEGKRGGKVIGTKRIVDDALKQCPEVKNVLVYRRTGSEVP
WTQGRDYWWHEEVNKYPGYCPPTLMDSEDPLFLLYTSGSTGKPKGGTPAYPDFSRYWDII
EKHGITQFYVAPTALRLLKKAGDHHINKQMKTLRVLGSVGEPIAEDVWKWYHEKVGRGEC
HVVDTYWQTETGSHAIAPMAGVTPTKPGSATLPFFGIEPAIIDPVTGDELHGNGVEGVLA
IKRPWPSMARTVWASHQRFMETYLNVYKGYYFTGDGAGRDHEGYYWIRGRVDDVVNVSGH
RLSTAEIEAALIHHEAVAEAAVVGIADELTGQTVNAFVSLKDSFENSSEMRKSLTLQVRK
SIGPFAAPKAVHVVNDLPKTRSGKIMRRVLRKILSGEEDQLGDTSTLSDPSVVGTILETL
HETGNK
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaagcagaggtttccgtggtgagtgaggcgcataatgttgagacctaccaagtt
ccccgcaagtattatgagaagcacccagccaaacctcatttgacgttggaggagtacaag
gctcagtatcgtgaatccatcgagaacccggataaattttggggggagaaagcgagagaa
cttcttcactgggatattccatttcagaccgtaagaaatggatcctttcagcatggggac
atcagctggttccttgagggccgtttgaacgcttgctacaattgtgtcgacagacatgct
ttcaaggatcccgagagacccgcgattatctacgaagccgacgagccgtccgaaggccgc
gtgatcacatacagtgagctccttcgtgaggtatgcaagttggcctttgtcctaaggcag
atgggtgtcaggaagggagataccgtcgccatttacatgcccatgatcccggaggccctg
gtcgcattcttggcaatcgttagaatcggagcggttcactccgtcgtgtttgccgggttc
tcggctgaatctctccgcgatcgggttctggatgcgcgctccaaagtggtaatcaccact
gatgagggcaagcgcggtggaaaggttatcggaaccaagcggattgtggacgacgcattg
aagcaatgccctgaagtcaagaacgtacttgtctaccgtcgtaccggatcggaggtgccc
tggacccagggtcgtgattattggtggcatgaggaggtcaacaagtaccccggttactgt
ccgcctacccttatggactcagaggaccccttgttcctgctgtacacctccggatccact
ggaaagcctaagggtggcacacccgcatacccggatttttcgagatattgggatatcatc
gagaagcacggaattacccaattctatgtcgcaccaaccgcattgaggctgttgaagaag
gccggcgaccaccacatcaacaaacagatgaagaccctgcgagtattgggctcagtcggt
gaaccaatcgctgaggacgtgtggaagtggtatcatgagaaggttgggcgtggggaatgc
catgttgtagatacgtactggcaaactgagaccggttctcacgctattgcgcccatggct
ggtgttactccaaccaaacctggaagtgctacgcttcctttcttcggaattgaacccgct
atcattgatccggtaactggtgatgaattacacgggaacggggttgagggagttttggct
atcaagaggccatggcccagtatggcgagaacggtctgggcctctcaccagagattcatg
gagacgtatttgaatgtctacaagggttactatttcaccggcgatggcgcggggagagat
catgaaggatactactggatccgtggtcgagtagacgacgttgtcaacgttagcggtcac
aggttgtcaaccgcagagatcgaggccgccctcattcatcatgaggctgttgccgaggct
gctgtagtcggtattgccgatgagttgactggccagactgtcaacgccttcgtctcgcta
aaggacagcttcgagaactcttctgagatgaggaagagtttgacccttcaagtccggaaa
tccattggaccgttcgcagcccccaaggcggtgcacgtggtcaatgaccttcctaagact
agatcgggaaagattatgagacgcgtcctccgaaagatcctatccggcgaagaggatcag
ttgggtgatacctcgaccttgtcggacccttctgtcgttggtaccatacttgagacactg
cacgagactggaaacaagtag

DBGET integrated database retrieval system