KEGG   Tuber melanosporum: GSTUM_00002470001Help
Entry
GSTUM_00002470001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
tml  Tuber melanosporum
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:tml00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 594 aa AA seqDB search
MASKNGAASYGTGAELDAAGTRRRNVPGGSLVGGDIVVPALEDTKKQQKIDQAGDVDIEA
IVAPIFFTLLSFFTRLYKIGQSNIVTWDEAHFGKFGSHYLKREFYFDVHPPLGKMLVGLS
GWMAGYNGSFEFKSGEVYPEGLNYTFMRVFNATFGALCVPLAYFTAKELKLSKPAVWLVT
LMVLCENSYATISRFILLDSMLLFFTFTTMLCFARFHRLQTKSFSPQWWLWLVLSGLSIG
CVCSVKWVGLFVTGVVGLYTIEDLWNKFGDLKMPKIVYAQHWVARIIGLIVIPMVVYMWS
FWMHFAILENSGPGDAQMSSLFQANLKGTDLTDSPLEIALGSPGNVNLPQWGFKQIEVTC
TKKNNPRDVFTHWNVESHWNEKLPNADVKAFRSPFLRDFIHLNVAMMTSNNALVPDPDKQ
DDLASAYWQWPILHVGLRMCSWDDGIVKYFLLGNPMVYWGSTLALPLFSLLVLLYLIRWQ
RGYNDLDGEGIDHIRAAGIYPLIGWVFHYVPFIAMARVTYVHHYYPALYFAILVFGFLFN
HLTNKLPKTAKLAVYGVAYVAITGVFVLFIPISFGMTGSSEQYKYLNWLPTWRI
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgaaaaacggtgcggcctcctacggcacaggtgctgagttggatgctgccggg
acgaggagaagaaacgtacctggtggatcactagtcggaggcgatatcgttgtgccagca
ctggaggatactaagaaacagcagaagattgatcaagctggtgatgtggacatcgaggct
atagtagctccgatattcttcacactcttgtccttcttcacgaggctatacaagatcggg
cagtctaatatcgttacatgggatgaagcacactttggaaaatttggatctcattacctt
aagcgcgaattctacttcgatgtgcatcctccgcttggaaagatgcttgtgggtctctcg
ggttggatggccgggtataatggctcttttgagttcaagtctggagaagtttacccggaa
ggacttaactataccttcatgagagtcttcaatgctaccttcggagctctgtgtgttcct
cttgcctactttaccgccaaggaattgaaactttcgaagcctgcggtatggctggtgact
ctgatggttttgtgtgagaactcgtatgctaccatcagcaggtttatcttgctcgattct
atgcttctgttctttaccttcactactatgctttgcttcgcacggttccacagactccaa
accaagtctttctcgccccagtggtggctgtggctggttcttagcggactctcaatcggt
tgtgtctgcagtgttaaatgggttggactgtttgttaccggagttgttggcctttacact
atcgaggacttgtggaacaagttcggagatcttaagatgcccaagattgtatatgcacaa
cattgggtcgctcgcattattggccttattgtgatccctatggttgtttacatgtggagt
ttctggatgcacttcgctatcctcgagaattctggccccggagatgcccagatgagctct
ctgttccaggctaacctcaaagggacggaccttaccgatagtccgttggaaatcgctctt
ggctcaccgggaaatgtcaatctgcctcagtggggtttcaagcagattgaggttacttgt
accaagaagaataacccaagggatgtttttacccactggaacgtcgagagccattggaat
gaaaagcttccaaatgcggatgtcaaggcattcagatcgccgtttcttcgtgatttcatt
cacttgaatgttgctatgatgacctccaacaacgctttggttccagatcccgacaagcaa
gacgacctggcatctgcttactggcaatggccgattcttcacgttgggttgaggatgtgc
agctgggatgatggtatcgttaaatacttccttttgggaaaccctatggtgtactgggga
tcgactctggcactccccctattctcacttttggtccttttatacctcatccggtggcag
cgtggatataacgatctggatggcgagggaattgatcacattcgcgccgcaggaatatac
cctcttatcggttgggtcttccactatgttccttttatcgccatggcgagagtaacatat
gttcatcattactaccctgctctttattttgcgatcttggtatttgggtttctttttaat
catctcaccaataagttgcccaagacagcaaagttggctgtatatggtgtggcctatgtg
gctatcaccggcgtttttgtgctctttattccaatctcgtttggtatgacgggctcatca
gaacagtacaagtatttgaattggctgcctacctggagaatataa

DBGET integrated database retrieval system