KEGG   Tuber melanosporum: GSTUM_00002654001Help
Entry
GSTUM_00002654001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K06101  
histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43]
Organism
tml  Tuber melanosporum
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    GSTUM_00002654001
Enzymes [BR:tml01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     GSTUM_00002654001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 901 aa AA seqDB search
MWANSPPRSSSPDRASDSIPPQPSSSASSTVSTSATNQSTVATSLSITPDRETLVLPDDT
IISKPIDSGKHSLPINAEQSDVRATEEPEAGPIEVDGAENATEDVKEEHGDGRSGAQEQT
RTTRNLRHRSRTVGGSTPSTPAPTKPTKGSKAAPDAACRRSLRSADKPKPPNTSDVHKAK
PNATRRHSQRIQVAAATAAKLAATTTPAPSRGKRSHEVMAAGSKSAGPKLQNSVPATVST
VSSKPDDDAPRSSKRARKVLSYDEDKHDEQLALSLTHSTSGALATNPRKRKKIWLNQGLY
LGQEQDIDVTRRPSGGSRKRGKATEKKKPSVLPMPMFTGSRIMETERDFKLPFNVFAPSP
WRCGPIPDWRKLNHNVLIGDAASHWRKEKASTAKCVCAEEVGCDENCLNMCTWVECDEGN
CNVGVERCTNRAFADLKERVKSGTKFAEGVEVVKTANCGHGLRATRGFMPNQIIVEYTGE
IITQEESERRMVEVYKDNKNYYLMLFHQNMILDATRGSVARFVNHSCDPNCRMEKWLVEG
RPRMALFAGDDGIEAGEELTYDYNFNWFTGVSQQTCHCGADNCRGALGKKADGFQRASPP
VKGKDKAKGKAGAAPRSKQASAKVRTRVAPKSKVAVKGKATAKTRAAAKTTKITRPIKSR
TTMAARGKGVIRATVRETAVRTQRSVRAGSSRVRGMEAGEIEAAGEAEAVEKDSEQSDME
GLESIRVASSPGQAVLSDLARKRIRNRGGKPRVTKTYKVGKTIRAKYYKGKLGPRKKAIQ
DAITPLLASESSPESATITVATTARTYREIAPKPPFDAEASSSMSSTSGTSVSGRVGVRR
SVRKSAAPNAGQNTVQTFEALVAGHPTTALSQALNTVLATSVESEALATGVGLLGSVECT
V
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
atgtgggcaaattcacctccccgttcttcctcaccggaccgtgccagcgactctatccca
ccgcaaccgtcgtcttcggcttcttctaccgtctccacttcagccaccaatcagtcgaca
gtcgcgaccagtttgtcgattaccccagatagagaaacccttgttctaccagacgatact
ataatttccaaacccattgattctggcaaacattcacttccaatcaacgcggagcaatcg
gatgtcagagcaaccgaggaaccagaggctgggccaatagaggtcgacggagctgaaaat
gctacggaagacgtcaaagaagagcacggtgatggcaggagcggagcgcaggagcaaacg
cgcactacgcgtaatctaaggcatcgctcccgtacggtaggcgggagcacaccatcaaca
cccgcccctaccaaacccacaaaggggtcgaaggcggcaccagatgcagcctgcaggaga
agtcttagatcagcagacaagccgaaacccccgaatacttctgatgtccataaagctaag
ccgaatgcgacgcgtcgccatagtcaacgcatacaggttgcggccgcaaccgctgcgaag
ctcgctgcgactacaacaccggctccatcacgcggaaagaggtcccacgaggtaatggct
gccggatctaagagtgccggtcctaaattacagaactctgtcccggctactgtttcgact
gtctcctcaaaacccgacgatgatgccccaaggtccagtaaaagagcgaggaaggttttg
tcttatgatgaggacaagcacgatgaacagttggctttatcattgacgcatagtacgtct
ggagctctggctacgaatccaaggaagaggaagaagatctggttgaaccaaggtctatat
ttaggccaagagcaagacatagatgttacaaggcgcccatccgggggatcgagaaaacgt
ggaaaggccacggagaaaaagaagccgtccgtcttacccatgcccatgtttaccggatcg
aggattatggaaaccgaaagggacttcaagctcccatttaacgtgtttgcgcccagtccg
tggaggtgtggacccattccggactggaggaaactgaatcataatgttttgattggcgac
gccgcctcccattggagaaaagagaaggcttctacagccaagtgcgtttgcgctgaagag
gtcggctgtgatgagaattgcctcaatatgtgtacctgggtagaatgtgatgaaggcaac
tgcaatgtcggagttgagcgctgcacaaacagagctttcgcggacctcaaggagagggtg
aaatctggcacaaagtttgcggagggagtcgaagttgtcaagactgccaactgcggacat
ggcctgagggcaacaaggggctttatgcccaatcagatcatcgtggagtatactggtgaa
ataattacccaggaagagagcgagcgtagaatggtcgaggtctataaggataataagaac
tactaccttatgttgtttcaccaaaacatgatacttgacgcaaccagaggctcggtcgct
agatttgtcaatcattcgtgtgatcccaattgtcggatggagaagtggctggtcgaaggt
agacctagaatggcactgtttgccggggacgatgggatcgaagctggagaggagctcaca
tacgactacaatttcaactggtttactggcgttagccaacagacttgtcattgtggggct
gacaactgtcgtggggctctggggaagaaagctgatggctttcagagagcatctccgcct
gtcaaaggcaaagacaaagccaaaggaaaggctggggctgctccgaggagtaaacaagct
tcggctaaagttagaactagggttgcgcccaagagcaaagtggcggtcaagggcaaagcg
acagccaagaccagagccgcggccaagaccacgaagatcactaggcccatcaaatccaga
accacgatggcggcaagaggaaagggtgttataagagctaccgtcagggaaacagcagtc
agaacccagcggtcagtcagggccggctctagtcgtgttcgtgggatggaagccggagag
atcgaggcggctggggaggctgaggcggttgaaaaggacagcgagcagagtgatatggag
gggttggaatctatacgtgtggcgtcttctcctggccaggcagttttatccgacttggcc
cgcaagagaatccgcaatcgcggtggaaagccccgtgttaccaagacctacaaggttgga
aagacgattcgtgccaaatattacaaagggaaattgggccctagaaagaaggctatccag
gatgcaattactccactactagcgtctgagagctcccctgaatctgctactataactgta
gctacaactgctaggacatatagggagatcgcaccgaaaccaccttttgatgcagaagct
tcgagttcaatgagcagcactagtggtacttcggtttctggcagagtaggtgttagaaga
tcagtcaggaagagtgctgcccctaatgcggggcaaaatacggtccaaactttcgaagca
cttgttgccggacatccgactacggcgctcagtcaagcgttgaatacagttcttgctaca
agcgtcgaatcggaggctctcgcaactggcgttgggctattgggcagtgtcgaatgcact
gtctaa

DBGET integrated database retrieval system