KEGG   Tuber melanosporum: GSTUM_00002741001Help
Entry
GSTUM_00002741001 CDS       T01282                                 

Definition
(RefSeq) hypothetical protein
  KO
K07204  regulatory associated protein of mTOR
Organism
tml  Tuber melanosporum
Pathway
tml04136  Autophagy - other
tml04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:tml00001]
 Cellular Processes
  Transport and catabolism
   04138 Autophagy - yeast
    GSTUM_00002741001
   04136 Autophagy - other eukaryotes
    GSTUM_00002741001
Membrane trafficking [BR:tml04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    GSTUM_00002741001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 HEAT Cnd1 HEAT_EZ HEAT_2
Motif
Other DBs
NCBI-GeneID: 9184109
NCBI-ProteinID: XP_002836445
INRA: GSTUM_00002741001
UniProt: D5G7Z3
AA seq 1040 aa AA seqDB search
MELRAKDPNALVTTSYSDCIQLAACGSKETLPMNPDLPADLFTCCLTTPIEIAIRFFVLQ
NPLPSNLTVEQAMKIPGRLQERRTPLGELNWIFTAITDTIAWNTLPRPLFKKLFRQDLMV
AALFRNFLLSQRIMRVHQCHPISSPPLPETHHHPLWQSWDLAVEMVLAQLPALNRATDGG
PAYEYQHSGFFTEQLTAFEVYLSQGAIDRKPPDQLPIVLQVLLSQVHRLRALILLSKFLD
LGPWAVNLALSIGIFPYVLKLLQSAAQELKPVMVFIWARILAVDASCQADLLKDNGYSYF
IQILSPASGIPVGNASEHRAMCAFILAMFCRGFHQGQVVCMPPNVMGACLAHLGDENPLL
RQWACLCLSQLWHDFAEAKWQGIREGAHLRLCELATDNVPEVRAAVLYALTSFLGIPEMS
EEVAKIEQDVAGSLLIMTADGSNMVRKELVIFLSMFVKRNEGKFLVAAFEQMVQERDDLT
ANGSAKKKDTLGAISPNTIFSAIWQALLMFSVDPFPEIGQAAQIVVDYVHLALLQSPLGQ
YAQDVIEEISRANLRSFNLTLPTNSMPESKRPMALGYASGETTPTNSAPATPKTLKGSWL
ANGSAERSPEWNRPPDANDPQSSSTSYRTAKEPITRNFHAKGVDKIPSIPLKSQFMEWSI
EYFREPQMKPNEADEPGSVDYNQRLWRRTRNDRIIIDTQTQKERASASRWDHNKGVFNNG
SLPMRLLFHQFESHLIAVDEKDSVSVWDWAKGVKTNHFSNGNPTGTKITEIKFLNEDDVA
LLMTGSGEGVVRIYRNYENDGEVELVSSWRALTDLLPSRRSSGLVAEWQQGRGTMLVGGD
VRVIRVWDAPREMCMSDIPARSGSCITSLTSEQVAGNIFVAGFGDGAVRIYDRRLAPRDS
MVKVWKQHKAWIVKAHMQRGGMRELVSGSATGEVKLWDIRMDNPVRGFLAHTKGMRSLSV
HEHAPIIATGSTWHDVKLWNTSTPKDLPLSTIKPYSSFLHQNRSNPVTGLAFHPHRMMVA
CSGAGDNHISLYNCDSKGGI
NT seq 3123 nt NT seq  +upstreamnt  +downstreamnt
atggagctacgggccaaggacccgaatgctctagttaccacgtcgtatagcgattgtata
cagttggctgcctgtggaagtaaggagacgctgcctatgaatccggatttaccggcggac
ctgttcacttgctgcttgacgaccccgatcgagatagcgattcgttttttcgtgcttcag
aacccattgccttcaaatttgacagtcgaacaggcgatgaagattcctggccgtctccag
gagcgtagaacgccactcggcgagctcaattggattttcactgctatcactgataccatt
gcttggaacacccttcctcggcccttgtttaagaaactctttagacaggacttgatggtg
gcagcgttgtttaggaattttttgctaagtcagaggattatgagggttcaccaatgccat
ccgatctcctcaccccccctaccagagacacaccatcacccgttatggcagtcgtgggat
ttggcggtcgaaatggtgctggcgcagttaccggcgttgaatagagctactgatggtggc
cccgcatacgaatatcaacattctggattcttcactgagcagctcacagccttcgaggtt
tatctttctcagggcgcgattgatagaaagcctccagatcagcttccaattgtgcttcaa
gttttgcttagtcaggtgcatcgtcttagagcactcattttgctcagtaaattcctcgat
ttgggtccctgggctgtgaatctggcattgagcattggtattttcccctacgtgcttaag
cttttgcagtcggcggcgcaggaattgaagcccgtgatggtgtttatttgggcgaggata
ttggccgtcgatgcttcctgccaggcggatttgttgaaggataatgggtacagctacttc
atccagatcctcagtccagcctctggaatccctgtcggaaacgcaagtgaacatcgcgct
atgtgtgcttttattctcgccatgttctgcagaggatttcaccagggccaggtggtctgc
atgcctccgaatgttatgggcgcatgtcttgcccaccttggagacgagaatccattgttg
aggcagtgggcatgtctctgcttgtcacaactttggcacgactttgccgaggccaagtgg
caaggcatcagggagggtgcacacttaagactttgtgaacttgctacggacaacgttccg
gaggtccgggcggcggtattgtatgcactcacaagtttcttagggatcccggagatgagc
gaggaggttgcaaagattgagcaggatgttgcggggtcgctcttgataatgacagccgat
ggaagtaatatggttagaaaggagttggtaatattcctcagtatgtttgtcaagaggaat
gaaggaaagttcttggttgcggcattcgagcagatggtccaagagagggacgatcttact
gcaaatggttcagctaaaaagaaggatactctcggcgctatttcgcctaataccattttc
tcagcaatatggcaagcgttgctcatgttctccgtcgatccgttcccagagattggtcag
gctgcccagattgttgttgattatgtccacctcgcacttttgcagagcccacttggccag
tatgcccaggatgtcattgaggagatttcccgcgccaatctgcgtagcttcaaccttact
ttgcccaccaattcgatgcccgagagcaagcgtcccatggctttgggatatgccagtgga
gagacgacacctactaattctgcgcccgcaacaccgaagacattgaaggggagctggtta
gctaatgggagcgcagagagaagccctgaatggaatagacccccagacgcgaacgaccca
cagagctcgtccacaagctatcgcactgccaaggaaccgattactcgtaattttcatgct
aaaggagttgacaagattcctagtattccgcttaaaagccagtttatggaatggtctatt
gagtacttccgcgagcctcaaatgaaaccgaatgaggccgacgagccgggcagtgttgat
tataaccagcgtttgtggcgtagaacgcgaaatgacaggattatcatcgacacacagact
caaaaggagcgggcgagcgcttcaagatgggatcataataagggtgttttcaacaacggg
agccttcctatgaggttgctgtttcatcagttcgagagccatctcatagctgtggatgaa
aaggatagtgtatcggtatgggactgggcaaagggtgtgaaaaccaaccatttttcgaat
ggcaatcctaccggcacaaagatcactgagattaagtttcttaatgaggacgatgttgct
ctattgatgactggtagcggggagggtgtcgttcgtatttaccggaattatgagaatgac
ggtgaagtcgagctggtctctagctggagagctcttaccgatctgttgccttctaggaga
agctctgggttggttgctgaatggcagcagggaagggggacaatgctcgtcggaggagat
gtgagggttatcagagtctgggacgcaccgagggagatgtgcatgagtgatatccccgca
cgctccgggtcctgcattaccagcttgacatctgaacaggttgctggcaacatctttgta
gctggcttcggtgatggagcagtcaggatatatgatcgccgtctggcgcctcgagactcg
atggtgaaggtttggaaacaacacaaagcctggattgtaaaagcgcacatgcaacgaggt
ggcatgcgtgagttggtatctggaagtgcaacgggcgaggtcaagctctgggatatccgc
atggataatccggttaggggattcctcgcacatacaaagggaatgagaagcttgagtgtt
catgagcatgctcctatcattgcaactggctcaacctggcatgatgtgaaactctggaat
acctctactcccaaggacctcccactctcaacaataaagccctacagcagcttcctacac
cagaaccgcagcaatcccgtgaccggactcgctttccaccctcaccggatgatggtagcc
tgctccggcgctggagacaaccatatcagtctttacaattgtgattccaaaggcgggatt
tag

DBGET integrated database retrieval system