KEGG   Tuber melanosporum: GSTUM_00002741001Help
Entry
GSTUM_00002741001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
tml  Tuber melanosporum
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 1040 aa AA seqDB search
MELRAKDPNALVTTSYSDCIQLAACGSKETLPMNPDLPADLFTCCLTTPIEIAIRFFVLQ
NPLPSNLTVEQAMKIPGRLQERRTPLGELNWIFTAITDTIAWNTLPRPLFKKLFRQDLMV
AALFRNFLLSQRIMRVHQCHPISSPPLPETHHHPLWQSWDLAVEMVLAQLPALNRATDGG
PAYEYQHSGFFTEQLTAFEVYLSQGAIDRKPPDQLPIVLQVLLSQVHRLRALILLSKFLD
LGPWAVNLALSIGIFPYVLKLLQSAAQELKPVMVFIWARILAVDASCQADLLKDNGYSYF
IQILSPASGIPVGNASEHRAMCAFILAMFCRGFHQGQVVCMPPNVMGACLAHLGDENPLL
RQWACLCLSQLWHDFAEAKWQGIREGAHLRLCELATDNVPEVRAAVLYALTSFLGIPEMS
EEVAKIEQDVAGSLLIMTADGSNMVRKELVIFLSMFVKRNEGKFLVAAFEQMVQERDDLT
ANGSAKKKDTLGAISPNTIFSAIWQALLMFSVDPFPEIGQAAQIVVDYVHLALLQSPLGQ
YAQDVIEEISRANLRSFNLTLPTNSMPESKRPMALGYASGETTPTNSAPATPKTLKGSWL
ANGSAERSPEWNRPPDANDPQSSSTSYRTAKEPITRNFHAKGVDKIPSIPLKSQFMEWSI
EYFREPQMKPNEADEPGSVDYNQRLWRRTRNDRIIIDTQTQKERASASRWDHNKGVFNNG
SLPMRLLFHQFESHLIAVDEKDSVSVWDWAKGVKTNHFSNGNPTGTKITEIKFLNEDDVA
LLMTGSGEGVVRIYRNYENDGEVELVSSWRALTDLLPSRRSSGLVAEWQQGRGTMLVGGD
VRVIRVWDAPREMCMSDIPARSGSCITSLTSEQVAGNIFVAGFGDGAVRIYDRRLAPRDS
MVKVWKQHKAWIVKAHMQRGGMRELVSGSATGEVKLWDIRMDNPVRGFLAHTKGMRSLSV
HEHAPIIATGSTWHDVKLWNTSTPKDLPLSTIKPYSSFLHQNRSNPVTGLAFHPHRMMVA
CSGAGDNHISLYNCDSKGGI
NT seq 3123 nt NT seq  +upstreamnt  +downstreamnt
atggagctacgggccaaggacccgaatgctctagttaccacgtcgtatagcgattgtata
cagttggctgcctgtggaagtaaggagacgctgcctatgaatccggatttaccggcggac
ctgttcacttgctgcttgacgaccccgatcgagatagcgattcgttttttcgtgcttcag
aacccattgccttcaaatttgacagtcgaacaggcgatgaagattcctggccgtctccag
gagcgtagaacgccactcggcgagctcaattggattttcactgctatcactgataccatt
gcttggaacacccttcctcggcccttgtttaagaaactctttagacaggacttgatggtg
gcagcgttgtttaggaattttttgctaagtcagaggattatgagggttcaccaatgccat
ccgatctcctcaccccccctaccagagacacaccatcacccgttatggcagtcgtgggat
ttggcggtcgaaatggtgctggcgcagttaccggcgttgaatagagctactgatggtggc
cccgcatacgaatatcaacattctggattcttcactgagcagctcacagccttcgaggtt
tatctttctcagggcgcgattgatagaaagcctccagatcagcttccaattgtgcttcaa
gttttgcttagtcaggtgcatcgtcttagagcactcattttgctcagtaaattcctcgat
ttgggtccctgggctgtgaatctggcattgagcattggtattttcccctacgtgcttaag
cttttgcagtcggcggcgcaggaattgaagcccgtgatggtgtttatttgggcgaggata
ttggccgtcgatgcttcctgccaggcggatttgttgaaggataatgggtacagctacttc
atccagatcctcagtccagcctctggaatccctgtcggaaacgcaagtgaacatcgcgct
atgtgtgcttttattctcgccatgttctgcagaggatttcaccagggccaggtggtctgc
atgcctccgaatgttatgggcgcatgtcttgcccaccttggagacgagaatccattgttg
aggcagtgggcatgtctctgcttgtcacaactttggcacgactttgccgaggccaagtgg
caaggcatcagggagggtgcacacttaagactttgtgaacttgctacggacaacgttccg
gaggtccgggcggcggtattgtatgcactcacaagtttcttagggatcccggagatgagc
gaggaggttgcaaagattgagcaggatgttgcggggtcgctcttgataatgacagccgat
ggaagtaatatggttagaaaggagttggtaatattcctcagtatgtttgtcaagaggaat
gaaggaaagttcttggttgcggcattcgagcagatggtccaagagagggacgatcttact
gcaaatggttcagctaaaaagaaggatactctcggcgctatttcgcctaataccattttc
tcagcaatatggcaagcgttgctcatgttctccgtcgatccgttcccagagattggtcag
gctgcccagattgttgttgattatgtccacctcgcacttttgcagagcccacttggccag
tatgcccaggatgtcattgaggagatttcccgcgccaatctgcgtagcttcaaccttact
ttgcccaccaattcgatgcccgagagcaagcgtcccatggctttgggatatgccagtgga
gagacgacacctactaattctgcgcccgcaacaccgaagacattgaaggggagctggtta
gctaatgggagcgcagagagaagccctgaatggaatagacccccagacgcgaacgaccca
cagagctcgtccacaagctatcgcactgccaaggaaccgattactcgtaattttcatgct
aaaggagttgacaagattcctagtattccgcttaaaagccagtttatggaatggtctatt
gagtacttccgcgagcctcaaatgaaaccgaatgaggccgacgagccgggcagtgttgat
tataaccagcgtttgtggcgtagaacgcgaaatgacaggattatcatcgacacacagact
caaaaggagcgggcgagcgcttcaagatgggatcataataagggtgttttcaacaacggg
agccttcctatgaggttgctgtttcatcagttcgagagccatctcatagctgtggatgaa
aaggatagtgtatcggtatgggactgggcaaagggtgtgaaaaccaaccatttttcgaat
ggcaatcctaccggcacaaagatcactgagattaagtttcttaatgaggacgatgttgct
ctattgatgactggtagcggggagggtgtcgttcgtatttaccggaattatgagaatgac
ggtgaagtcgagctggtctctagctggagagctcttaccgatctgttgccttctaggaga
agctctgggttggttgctgaatggcagcagggaagggggacaatgctcgtcggaggagat
gtgagggttatcagagtctgggacgcaccgagggagatgtgcatgagtgatatccccgca
cgctccgggtcctgcattaccagcttgacatctgaacaggttgctggcaacatctttgta
gctggcttcggtgatggagcagtcaggatatatgatcgccgtctggcgcctcgagactcg
atggtgaaggtttggaaacaacacaaagcctggattgtaaaagcgcacatgcaacgaggt
ggcatgcgtgagttggtatctggaagtgcaacgggcgaggtcaagctctgggatatccgc
atggataatccggttaggggattcctcgcacatacaaagggaatgagaagcttgagtgtt
catgagcatgctcctatcattgcaactggctcaacctggcatgatgtgaaactctggaat
acctctactcccaaggacctcccactctcaacaataaagccctacagcagcttcctacac
cagaaccgcagcaatcccgtgaccggactcgctttccaccctcaccggatgatggtagcc
tgctccggcgctggagacaaccatatcagtctttacaattgtgattccaaaggcgggatt
tag

DBGET integrated database retrieval system