KEGG   Tuber melanosporum: GSTUM_00002749001Help
Entry
GSTUM_00002749001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
tml  Tuber melanosporum
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GSTUM_00002749001
   00330 Arginine and proline metabolism
    GSTUM_00002749001
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    GSTUM_00002749001
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    GSTUM_00002749001
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    GSTUM_00002749001
Enzymes [BR:tml01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     GSTUM_00002749001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 365 aa AA seqDB search
MSEKSKVAVVGAGVAGLTTALLLSKRGHSVAVVAKHMPGDYDIEYTSPWAGASYLPVSAP
GTREAEWDQITFAELYRLTTQVPEAGIHFQDVITYRREKDKGSVTADWFSELLKERPWFA
NIVPEFRTIPKADLPPSVDFGTRWKSMCINPAIYLPYLLSQCLKRQVRFRRGTLTHICEA
VNFHPEYTSCSDIAVVNCTGLGSYTLSGVTDSSLTPARGQIVLVRNTAPAIIEVSGTDDG
EDEVTYIMTRAAGGGTVLGGTYQKGNWSSAPDEATAERIKKRAVEWCPELVGKGEGVEGL
DVIRHGVGLRPLRVGGARVEREVIGGARVVHNYGAGGFGYQASYGMAEEAVRLVEESLEE
VKARL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagaaaagcaaagttgctgttgttggtgccggcgtagcaggcctaacgaccgcc
ctcctcctctcgaagcgcggccattccgtcgccgtcgtggcaaaacacatgccgggggac
tacgacatagagtacacctctccgtgggcgggggcaagctaccttcctgtatcagcgccg
ggcacccgggaagcagaatgggaccagatcacttttgcagagctttacagactgaccacc
caagtcccagaggccggcattcacttccaagatgtgataacctaccgacgggagaaggac
aaggggagcgttacggcagattggttttccgagttgttgaaggaaaggccttggtttgct
aacatagttccggagttccgaacaatcccgaaagcggacctcccgccaagcgtcgacttt
ggcacgaggtggaagtcaatgtgcattaaccccgcaatatacctcccatacttactatcc
cagtgcctcaaacggcaggtgaggttccgccggggcacactaacgcacatctgcgaagcc
gttaacttccaccccgaatacacctcttgttctgatatagcagttgtaaattgcacaggc
ctgggatcttacaccctcagcggcgtcactgactcgagcctaactccggcccgtgggcaa
atagtcctagtccgtaacactgcgccggccataatcgaagtatcgggtacagacgacggc
gaggacgaggtgacgtacataatgactcgcgcggccggcggcggcacagttctggggggg
acgtatcagaaggggaattggagctctgctccggatgaggctactgctgagaggattaag
aagagggcggtcgaatggtgtccggagttggtggggaagggggaaggagttgaggggctg
gatgttataagacatggagtgggtttgaggcctctcagggtgggcggggccagggttgag
agggaggttattgggggtgcgagggttgtgcacaattatggggcgggggggttcggttat
caagcgagttacggaatggcggaggaagctgttaggttggtcgaggagagtcttgaggaa
gtgaaggcaaggctctga

DBGET integrated database retrieval system