KEGG   Tuber melanosporum: GSTUM_00002995001Help
Entry
GSTUM_00002995001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
tml  Tuber melanosporum
Brite
Enzymes [BR:tml01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     GSTUM_00002995001
Peptidases [BR:tml01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   GSTUM_00002995001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 313 aa AA seqDB search
MSGGWNTIESDAGVFTYLVDNLGVKNVQFEEMIALDADYLNQQSPVYGVIFLFKYPVGQK
KADEAVDGQYDFAASENIFFANQTIQNACATQAILSVLLNRGDLDLGDQLREFKEFTQAF
PAELRGEALSNSELIRGVHNSFARSSPFIDEGTRAATEDDDLYHFIAYTPINGILYEIDG
LQPSPISHGKCTEEQFPEKVIPVLQRRIERYPATEIRFNLLAMVQDLRIRAAEIGDVETV
AREDEKRKMWIWENELRRHNFVGFAHEVLKRAVASKLRDGKYDEWIDEAKQKAKDRMSER
KKVRGEKEDIASP
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgtctggcggttggaacactattgagtccgatgcaggagttttcacctaccttgttgac
aaccttggtgtcaagaatgtccagttcgaggagatgattgcgctggatgcggattatctt
aatcaacaatctcccgtttatggcgtcatcttcctattcaagtaccctgtcggccagaag
aaagccgacgaagcggtagatggtcagtacgatttcgccgcttctgagaatatatttttc
gcgaatcagacgattcagaatgcttgcgctactcaagctatcctctcggtgctgctcaat
cgtggagatcttgatctaggcgatcaattgagagagtttaaggagtttactcaggctttt
cccgcagagctccgcggtgaagctttgtcaaattctgagttgatccgtggcgttcataac
tctttcgctcgttctagtccctttattgatgagggcacccgtgctgctaccgaggatgat
gatttgtaccatttcattgcctacactcctatcaacggtatcctatacgagattgacggt
ctacagccctctcccatatctcacgggaagtgcacggaggaacaattcccagaaaaggtc
attccggtcttgcaacggaggatagagaggtaccctgccaccgagattcggttcaatttg
ttggcgatggtacaggacctgaggatcagggccgccgagatcggcgatgttgaaacggtt
gctcgggaggacgagaagaggaagatgtggatatgggagaatgagcttcgcaggcataac
tttgtcgggtttgctcatgaggtcttgaagagagctgttgcgagtaagcttagggatggc
aaatacgatgagtggatagacgaggcgaaacagaaggctaaagaccgaatgagcgagagg
aagaaggttagaggcgagaaggaggatattgcttctccttaa

DBGET integrated database retrieval system