KEGG   Tuber melanosporum: GSTUM_00002999001Help
Entry
GSTUM_00002999001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
tml  Tuber melanosporum
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:tml00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 673 aa AA seqDB search
MSDSNPPHSTDPQDSLLQKSHLSDENMGSQENPGSRHHAPSREQHMTSTGSVSSREQRAS
LAEQVKAWLRSEKQRQKDRREGKRALHRALHGHCPPGELVDSGDTPAPPDPDSSGDEETQ
NSLNQLEAILAGVQESSPADPSRHQSASSRRGSWGRSRARSLMVNASDTDYASEGEPVVR
SCEVHLETAEEVGIDEFRRQVLTLAHTLKCKGWRRVPLDRFRDISIERISGALTNTVSLS
FVDYPLVGFFPRQGTEASLRKLLLRIYGPQVSHLIDRETELSILRRLARRTIGPPLLGTF
ENGRFEEFFNATTLTKDDIKVPGTSRHIAMRLKELHKGIELEDRERKMGPASWCNWYKWA
PRAKQIMIYLDTAENLGKRGYICGCPWEKFEAAVEKYKEWLYDRYNGEENVKKQMVFAHN
DTQYGNILRLQPSGESPPPTPSNEHRQLVVIDFEYASANTPGFEFANHFCEWMSNYHDPV
SPHFMHHTRFPTFQERRNFLQAYVEHSLPSPFIAKSVSMPGTSSEPSTPPTLHPPAASSS
SAPSSMLDTRIPGASDEEVDRLEGEAKAWRAASHAMWCVWGIVQAKNPGSGTKAAVDGQQ
GGADGSVPGGAKAAAGDLGGVKPESEEDESEFDYLGYAQQRALLFWGDMLALEIMKPGEV
GDEVVEKAKIIAL
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgtctgattcgaaccccccgcattctacggatccccaagatagtctacttcaaaagtca
cacctatccgacgagaatatgggcagtcaagaaaaccccggcagtcggcatcacgcaccc
agccgtgaacaacacatgacttcaaccgggagtgtatccagccgtgaacaacgtgccagc
ctggccgagcaggtgaaggcgtggcttcgcagcgagaaacagcgacagaaagaccgccgc
gagggtaagagagctctccaccgagcgttacacgggcactgcccaccaggtgaattagtg
gacagtggtgacactcctgcccccccagacccagactccagtggcgatgaagagacacag
aattcattgaaccagttggaagctattcttgcaggggtccaggaatcctcacccgctgac
cctagccgccaccagagtgcctcaagtaggagaggctcctggggaaggtctcgagcgaga
tcgctgatggttaatgcatcggacacagactatgcttctgagggagaacctgtggttcgc
tcttgtgaggtgcatctagagactgctgaagaagtcggaattgacgagttcaggcgtcaa
gttttgacattggcacatacacttaagtgtaagggctggaggagagtgccattggatagg
ttcagggacatatctattgagaggattagtggagccttgactaataccgtgagtttatcc
ttcgttgactatccacttgtaggttttttccctaggcaaggaacagaagcctcactccga
aaattgcttctccgtatttacggaccccaagtctctcatcttatcgatcgtgagaccgaa
ttgagcattcttcgccgcttagctcgcaggacgatcggtcctcctcttttgggtacattc
gaaaatgggagattcgaggaattctttaatgcgacaactcttacaaaagatgatatcaaa
gtcccgggaacctccaggcatatcgcaatgaggctgaaggaattgcataagggtatcgaa
cttgaagatagggagaggaagatggggcctgccagttggtgcaattggtacaagtgggct
cctagggcaaagcagatcatgatatacctagatactgccgagaatttgggcaagaggggc
tatatatgtggatgtccatgggaaaagtttgaggcagccgttgagaagtataaggaatgg
ctatatgacaggtacaatggtgaagaaaacgtgaagaagcaaatggtctttgcacacaac
gacactcaatacgggaatatcctgagattgcagcctagtggggagagcccgcctccgact
ccgagcaacgagcatcggcagctcgtcgttatcgacttcgaatatgctagtgcaaatact
cccggatttgagtttgcgaaccacttttgcgaatggatgagcaactatcacgaccctgtc
tccccccactttatgcaccacaccaggttcccgaccttccaggagcggcgcaacttcctc
caagcctacgtagaacacagcctcccctccccatttatcgccaagagcgtttcgatgccc
gggacaagctccgagccctcaaccccgcccaccttacacccccccgccgcatcctcctcc
tcggcgccctcctccatgctcgacacccgcattcccggtgccagcgacgaggaagtcgac
agactggagggcgaagcgaaagcctggcgtgccgcgagccatgcaatgtggtgtgtctgg
ggcattgtgcaagccaagaatcctggatcaggaaccaaagctgcggtcgatggacagcag
ggcggcgccgatggatccgtgcctggaggggccaaggcggccgcaggcgatttgggtggt
gtgaagcccgagagtgaggaagatgagagcgagtttgattacctgggctacgctcagcag
cgggcattgctgttttggggtgatatgcttgccctagagattatgaagccgggggaggtt
ggcgatgaggttgtggagaaggcgaagattattgctttgtga

DBGET integrated database retrieval system