KEGG   Tuber melanosporum: GSTUM_00003008001Help
Entry
GSTUM_00003008001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
tml  Tuber melanosporum
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tml03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 870 aa AA seqDB search
MFGGKKFVPPLLKKPAPAAAGTDDQPAAKRAKIEPLGGGRSLKLGGPIKRKPLLLLRNPE
LGAAVAAGEEKGEEGAAGEAYFRVLWRKPTTKKHKTFDGDGVLAISGGYAVLQDTSGKDL
GRTMFKRTLEVGSTTFIAGKEIEVDSVLSREEYLAGRPFLKSAAPPPLPSPPSTTTSTAP
QKETFTVVAPGNFFGSKFKTPLLSSTVMGRTHSKVPTPRHDPKAEGALVMPRPNEKSVPA
GKVVVDVVVDPFISHSLRPHQREGVMFLYEAVMGLKPFDGRGAILADEMGLGKTLQTMLV
PLWMLIDVEQNPIYGGGPVVKRALIVCPVTLINNWNKEFRKWLGKERIGVLVADSKTNIR
DFTHGKSYSVMVIGYEKLQKVQQELSAADVDIVIADEGHRLKTEKNKSAQAIRGLKTKRR
VVLSGTPLQNDLHEYFIMVDFVNPGLLESYSTFKKEFENPIVRSRQPGASKKDVEKGKAR
NEELASLTKLFVLRHPQGNLRSTRAFWGLPPLKLCNSPGLLADKPGKETNENVKGLLAGV
NPKLLESKSDSHSGKFRVLERLLLALRNTTDEKIVLVSNYTSTLDLLQNLLRSRGLSYLR
LDGTTPTNKRQELVDQFNRTNSTTAFAFLLSAKSGGAGLNLIGASRLALFDLDWNPATDA
QAMARIHRDGQRREVKIYRMLTTGCFDEKIYQRQLTKIGLADSVMDQKATASSFTLEELR
DLFSLDTETNCLTHDLLCCECEGKGYVAGAAETKSPFFQHSEDEKEDSDEDDEPKYPGLM
KASEVDFEKVEEDRKKAMQKGRGVGVDKNQLSSLMEYSHILTTRLLGNRGRGGEEDDKEE
YDEVSIEDEVLAKVIRNGAAKEVSFVFQKT
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atgtttggcggaaagaagttcgtgcctccacttttaaagaagccggcaccagcggcagca
ggcacggatgatcaacctgcggcgaagcgtgcgaagatcgagccccttggtggtgggaga
tcattgaaacttgggggaccgattaagaggaagccgctactgctccttaggaacccggag
ctgggggctgcagtcgcggcgggggaggagaaaggggaggagggtgcagcgggggaggct
tattttcgtgtgctgtggaggaaaccgacgacgaagaagcataagacgtttgatggcgac
ggggttttggcgattagtggggggtatgctgtgcttcaggatactagcgggaaggatctc
gggagaacaatgttcaagcgaaccctcgaagttgggtcgactacgttcatcgccgggaag
gagattgaagtcgattcggtgctttcgagggaagagtaccttgccggcagaccgtttttg
aagagcgctgctccacctccactcccatcgcctccgtccactacaacgtcgacagcaccg
cagaaggaaacgttcacagtcgtagcaccggggaatttcttcggtagcaagttcaagacc
ccactcctcagttccactgttatgggaaggacccattcgaaagtgccaacacctaggcac
gatccgaaagcggagggtgctcttgtaatgccccgccccaacgagaagagtgtaccggct
ggaaaagtcgtcgtggacgttgttgtcgacccgtttatttcgcacagcctgcggccgcat
cagagggagggtgtgatgtttttgtatgaggccgtgatgggacttaagcctttcgatgga
cggggagcgattctggcggacgagatggggctggggaagactttgcagactatgttggtt
ccattatggatgctaattgatgtagaacaaaatccgatatatggcggtgggccggttgtc
aaaagagctcttattgtatgtcctgtgacattgatcaataattggaataaagagttccgg
aagtggctgggtaaagagcggatcggcgtgcttgtggccgattcgaaaacgaacattagg
gactttacccatgggaaaagctattctgttatggtcattggttacgagaagctacaaaaa
gtccaacaggaattaagtgctgccgatgttgacattgtcattgccgacgaggggcacagg
cttaagactgagaagaacaagtctgcgcaggctatccggggattgaagactaagaggagg
gtcgtccttagcggtactccgctgcagaatgaccttcatgagtattttatcatggtggac
tttgtcaatcctggactgcttgagagttactcgactttcaaaaaggagtttgaaaacccg
attgttcgaagccgacaacctggtgcttcgaagaaggatgttgagaaagggaaggcgcgg
aatgaagagcttgccagtttgacaaagttgtttgtgctccgccatccccaaggcaactta
aggtctacaagagcattctggggtcttccgcctttaaagctttgcaattcgccggggcta
ttggctgataagccagggaaagaaactaacgagaatgtcaaaggtctcttagcaggagtc
aatcccaagctactcgaatccaagagcgactcgcatagcgggaagtttagggttcttgag
cgccttctcctggccttgaggaataccaccgacgagaagattgtgctggtatcgaattat
acttctacgctcgacttgctgcagaatctcctccgctctagaggccttagctacttgagg
cttgacggaaccactccgaccaacaaaagacaggagcttgtcgatcagtttaatcggacc
aatagtactactgcttttgcgttcctactatctgcgaagagtggtggtgcaggtcttaac
ttgattggagcttctagactcgccctatttgatttggattggaatccagctacggatgcc
caggccatggcgagaattcatagagatggtcaaaggagagaggttaagatttataggatg
cttaccactggatgttttgacgaaaagatatatcaaagacaactcacaaagattggcctg
gcagattcagtcatggaccagaaggctaccgcaagtagttttactctagaggagttaagg
gatttattctccctcgacacggagaccaactgtctcacacatgatctactatgttgtgaa
tgcgagggcaaaggttacgttgctggggctgcggaaaccaagtcgccgtttttccagcac
agcgaggacgagaaagaagatagtgacgaagatgacgagccgaagtatcctgggctaatg
aaagccagtgaggtagactttgagaaggtcgaagaagaccgcaagaaggctatgcaaaag
ggtagaggcgttggcgtggacaagaaccagctcagttctctgatggaatactcgcacatt
ctgaccactcgtcttctgggcaacagggggaggggtggggaggaagacgacaaggaggaa
tacgatgaagttagtatcgaggatgaagtattggcgaaggttattaggaatggagcggcg
aaggaggttagctttgtttttcaaaaaacctag

DBGET integrated database retrieval system