KEGG   Tuber melanosporum: GSTUM_00003136001Help
Entry
GSTUM_00003136001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
tml  Tuber melanosporum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 666 aa AA seqDB search
MATQLDTLDVLVLAALLLGTIAYFTKGSLWAVEKDTITGIYGGSKANGAATKGSKTRDIV
KTMEESDKNMVIFYGSQTGTAEDYASRLAKEGSARFGLKTMIANLEEFDYENLDTLPEDK
VAVFVMATYGEGEPTDNAVDFYEFIMGDDVNFTEGDRLGNLKFIGFGLGNNTYEHFNAVI
RRLTATLLKLGAKQIGNIGEGDDGTGTMEEDFLAWKEPMWKALQEEMDLEEREAVYEPVF
SIAERTELSVEDDTVYLGEPNKNHLEGGSKGPYGANNPFIAPIKSSREIFTVKDRNCLHM
EIDLTGTNLSYTTGDHIAVWPTNAGKEVDGFLKVLGLEEKKDGVIDVTGIDSTAKVPFPT
PTTYDAIARYHLEICAPVSRQFLASLAAFAPTPTAKDELTRLGGDKDYFQETISSRYLNI
AQVLELNAPGEIWSNVPFSLMVEGLNRIQPRYYSISSSSLVQPKLVSITCHGDPEPDPHG
LSYAITGPRNKYDGIHVPVHTRASNFRLPSDPSKPVIMIGPGTGVAPFRAFVQERAALAE
KGERIGKTLLFFGCRKASEDFLYQEEWKEYASKLGDSFSLITAFSRDGPEKVYVQHRLKE
RAKEVNELLAQGSYFYVCGDAAHMAREVNTSLGSIIAQERGLTETQGEEIVKRLRSSNLY
QEDVWS
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atggccacccaactagacacgttggacgttcttgtccttgcggctctgcttctcggtacc
atcgcatacttcaccaaaggttcactatgggctgtcgaaaaagatactatcactggaatc
tatggaggctctaaggctaatggcgcggccaccaaaggcagcaaaactagggatattgtt
aagactatggaagaatccgataagaatatggttatcttttacggttcacaaacaggaaca
gccgaagattatgcctctagattggcgaaagagggcagcgctaggtttgggttgaagact
atgattgcgaaccttgaggaattcgactacgaaaatttggacactctcccagaagataag
gttgcagttttcgtcatggctacttatggtgaaggtgaaccgactgataacgctgtggat
ttctacgaattcatcatgggtgacgacgttaattttactgagggcgatcgcttgggcaac
cttaaattcattggctttgggttgggcaacaacacttatgaacattttaacgctgtcatc
cgccgtctaaccgcaactctcttgaaattgggcgctaaacagatcggcaacattggcgaa
ggcgacgatggtactggtactatggaagaggattttttggcctggaaggaacccatgtgg
aaagcacttcaagaggagatggatttggaggagagagaagctgtctatgaacctgttttc
tccattgctgagcgcacggagctttcggtcgaagacgacactgtctaccttggtgaaccc
aacaagaatcacctcgaaggaggttctaagggaccctatggagccaacaatcccttcatt
gcaccaatcaaatcctctcgtgaaatttttaccgtcaaggataggaactgcttgcacatg
gaaattgatcttaccggcacaaacctttcctacactaccggtgatcacatcgctgtttgg
cctaccaacgctggtaaagaggttgatgggtttttgaaagtcctcggtcttgaggagaag
aaggatggcgtaatcgatgttaccggaatcgattctactgcgaaggttccgtttccaaca
cccaccacctatgacgcgatcgcccgctatcatctcgagatctgtgctcccgtctcccgt
caatttcttgcgtctcttgctgctttcgccccaactcctactgccaaagatgaactcaca
aggctcggtggtgacaaagactacttccaggagacaatctcatctcggtatctcaacatt
gcacaggtcttggagctcaacgcgcctggcgagatttggtcaaacgtccctttctccttg
atggttgaaggactgaatcgtattcaaccacgttattactcgatctcatcctcttcgttg
gttcaaccgaaacttgtttcaatcacttgtcatggggacccggaacccgacccacatgga
ctcagctacgcaatcactggccccaggaacaaatatgacggtatccatgtcccggtccat
acccgggcgtcaaacttcaggcttcctagtgacccttccaagcctgttatcatgattggg
cccggtactggtgtagcacccttcagggcttttgttcaggaacgtgcagcgcttgcggag
aagggcgagaggattggaaagacattgctgttttttggttgtaggaaagcttctgaggat
ttcctataccaagaagaatggaaggaatatgcttcaaaactcggagattcgttctcactc
atcaccgctttctcacgtgacggacctgagaaggtgtacgtgcagcacagactgaaagag
cgcgccaaagaagttaatgagcttttggcacaaggtagctacttctatgtttgcggagac
gctgcccacatggccagagaggtcaatacctccctcggaagcatcatcgctcaggagagg
ggtttgacagagactcaaggagaggaaatcgtcaagagactgagatctagcaatctatac
caggaggatgtctggtcataa

DBGET integrated database retrieval system