KEGG   Tuber melanosporum: GSTUM_00003154001Help
Entry
GSTUM_00003154001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
tml  Tuber melanosporum
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tml00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    GSTUM_00003154001
   03420 Nucleotide excision repair
    GSTUM_00003154001
   03430 Mismatch repair
    GSTUM_00003154001
   03440 Homologous recombination
    GSTUM_00003154001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 348 aa AA seqDB search
MLVNQESLVLETLDDLAATRTRKACLEDLTRFDLIPTHLHSLTYSTSQRLTSKYIMDYGN
SYGGGGYTYGAGGGAGAGGFSTNYGGSQGGSQASPGGSASRGSRSASTLRPVTIKQVLEA
TQPHPEAEFKIDDVELTQLTLVAQIRAVSEQATNHTYKMDDGTGTLEVKQWVEATAVPDG
PSQKLQPNQYVRILGTLKAFGGKRHLGAHHIRPITDFNEIHYHLLEATAIHLHLTRGPPE
QFGQTTGVMGHQMHDQGRDVAMSGMGAAVRGGGGAYYCPPNASPHCRRILDVVRSKPQHT
DGTHVNTIAQMCGLSLTDVEKAIYELTEAGIAYTTIDDSHVTILEEQT
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgctggtaaatcaagagtctctggttcttgaaaccttggatgacttggcagccacgcga
acgcgtaaagcgtgtttagaagatctgactcgattcgatttaatccccactcatctccat
tctctcacctattctacctctcaacgactcacaagtaaatacatcatggattacggcaat
agctatggcggagggggttacacctacggggcaggcggtggagcaggcgcaggaggattt
tctaccaactacggcggttcgcagggtgggagtcaagctagtccaggtggaagtgcttca
cgcggaagtcgttctgcgagcactcttcgtcctgtcacaattaaacaggtacttgaggcc
acccagcctcatccggaagctgaatttaagatcgatgacgttgagctaactcagctcacc
cttgttgcacaaattcgtgccgtcagcgagcaagcaacgaaccatacctataagatggat
gatggcactggcaccctggaagttaagcaatgggttgaagccaccgctgttcctgatggg
ccttcccaaaagcttcagccaaaccaatatgtccggattctgggtaccctcaaagccttc
ggtggcaaacgccacctcggtgcccatcatatacgtcccatcacggacttcaatgaaata
cactaccaccttctagaggctacggcaattcatttgcacttgacaagaggcccccccgag
caatttggacaaacgaccggtgtgatgggacaccagatgcatgaccaagggcgagatgtc
gcgatgagtggtatgggtgcggcggtcagaggcggaggaggggcctactactgcccacct
aatgccagcccgcattgtaggaggatccttgatgtggtccggtccaaaccgcaacacaca
gatggaacacatgtcaacaccatcgcgcaaatgtgtggcttatccttgactgatgtcgaa
aaagccatctacgaattgaccgaggccgggattgcgtatacgacaatagatgatagtcat
gtcacgatattggaagaacaaacctaa

DBGET integrated database retrieval system