KEGG   Tuber melanosporum: GSTUM_00003192001Help
Entry
GSTUM_00003192001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
tml  Tuber melanosporum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tml01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:tml00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 346 aa AA seqDB search
MTAPSTIATKFLPAKDQLGLVAVGFSGGQCKSGVDAAPSALIESGLLADIQETLEYTLYH
DGVVHGYAKHLPVPGTDLPLRTAGAKAPMINPIAVSSVTHALCDQVYEHASKGRLVLTLG
GDHSIAIGSVAGTAKAIRERHNGSEMALVWVDAHADINTPESSGSGNIHGMPVSFLTGIA
RPPKENPDVFGWIKDEHRVNPSKIVYIGLRDVDIPEKKILKDHGIRAFSMHDIDKHGIGK
VMDMALDHINCGPGQEGMPIHLSFDVDALDPYVAPSTGTPVRGGLTLREGDFICEVIHET
GYLVAMDLVEVNPALSGDGPESISARETIRAGCSLVRCALGECLLG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgactgctccttcaactattgctaccaagttccttcccgcaaaggaccagcttggatta
gttgctgttggattctcgggtggccagtgcaaatccggtgttgatgccgctccttccgct
ttgattgagtctgggctcttggccgatattcaagagaccttggaatacactctttatcac
gatggggttgtccatggttatgcgaaacaccttcccgtaccgggaaccgaccttccgcta
cgcactgctggagcaaaggctcccatgatcaatcccattgctgtttccagtgttacgcat
gctctctgcgaccaagtttacgagcatgcttccaaaggacgccttgttctcaccttggga
ggtgatcactctattgctattggttctgttgccggcactgcaaaggcaatccgtgaacgt
cacaatggctctgagatggcccttgtctgggttgacgcccatgcagatatcaacacccct
gaatcttctggttctggcaatattcatggcatgcctgtttcctttttgactgggattgcc
agaccacccaaggaaaaccctgatgtctttggttggattaaggatgagcatagagtcaac
ccttccaagattgtttacattggccttcgtgacgtcgatattcctgagaagaagatactt
aaagatcatggcatccgcgctttcagcatgcacgatattgacaaacacggtattggcaag
gttatggacatggctcttgaccatatcaattgtggccccggacaagagggtatgccaatt
cacttgagtttcgacgttgacgccttggacccatatgtcgccccgagcactggtactccc
gtacgtggtggactcaccctgagagaaggagactttatatgcgaggttatccatgagact
ggatatctcgtggctatggatctcgtcgaggtcaaccccgccctctccggggatggccca
gagagcattagtgctagagaaaccattagagctggttgtagtctcgttcgctgcgccttg
ggagagtgcctcttgggttag

DBGET integrated database retrieval system