KEGG   Tuber melanosporum: GSTUM_00003326001Help
Entry
GSTUM_00003326001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tml  Tuber melanosporum
Brite
Enzymes [BR:tml01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     GSTUM_00003326001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 222 aa AA seqDB search
MSWRCSSTSNEGLISNLFRHGLIKNDTVDRAHFSPIMPYEDSPQRIGYDATISGISFHYK
NHAAEALLDRLGPGKTVLDVGSGSGYLTAVLAHLVAPGGVVVGIEHIQQLCDLSTENLKK
DPVHSRMLQDGTIKIIRGDGRLGYPEGGPFDAIHVGAAASIMPQALIDQLKAPGRMFIPV
DGGFSQYIWQVDKDEGGNVKKEKQYGVLYVPLTDAKDFRDEN
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgagttggagatgctcttctaccagcaacgaaggtcttatatccaatctgtttagacat
gggctcatcaagaacgatactgttgaccgggctcacttcagtcccataatgccgtacgaa
gactccccccaaagaatcggatacgatgctactatatccggtatatccttccactataaa
aatcatgctgctgaagctctcttagaccgattgggccccggcaagacggttcttgatgtc
ggaagcggcagtggatacctcacagctgtcctggcgcacttagtggccccgggtggagta
gtagtgggtatagaacatatccagcaattatgcgacctcagcacagaaaacctaaagaaa
gaccccgtgcactccagaatgcttcaagatgggacaataaaaatcattcgaggggatgga
aggcttggttatccagaaggtggaccgtttgacgcgattcatgttggtgctgcagcatct
atcatgccacaggcgcttatcgatcaacttaaggcaccaggcaggatgtttataccagtt
gatggaggcttcagtcagtatatttggcaggttgacaaggacgagggaggaaacgtaaag
aaggagaagcagtacggagtcctgtatgttccactcaccgatgcaaaggatttccgtgac
gaaaattag

DBGET integrated database retrieval system