KEGG   Tuber melanosporum: GSTUM_00003588001Help
Entry
GSTUM_00003588001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
tml  Tuber melanosporum
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    GSTUM_00003588001
Enzymes [BR:tml01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     GSTUM_00003588001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 487 aa AA seqDB search
MSTTITEALTGKVPFDVPYTLLSGRHWTTAQAHKPPSNKFVQPPPTAKHVNPAWGRFSGN
EWVTVMGCSAIVLFCPLLALLACVCLKHFDGGLLPTLWAFMTTHPVEFIVRYAPRPTAGA
SAAYAGWLLFQAALYAWLPSPIGYGQRTPAGHLLPYRVNGIHAWVVTHVVSVVAVYTGML
DPAVIAKNWEGLLVVANVYGYLLAVVAYLKAHLFPTHEADRKFSGSMVYDFYMGIELNPR
FGEWWDFKLFHNGRPGIVAWTLINLSFAAWQFQLHGYISNSMIIVNILHAFYVVDFFINE
DWYLRTIDICHDHYGFYLAWGSMVWLPGTYTLQAQYLARYPVDLSTPVAAAILLIGISGY
VVFRSVNYQKDIVRRTNGECNIWGKKAEVIRTTYKTEDGKMHESLLLCSGWWGIVRHANY
LGDLVLSYSGCAVCGVHNILPWWYAVFMTALLLQRCVRDHSRCLGKYGEDWERYCGRVKW
KLIPGVY
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgtccacgacaatcaccgaggcattgacagggaaggtcccattcgatgttccgtacacc
ctgctctcgggcaggcactggacaacagcacaagcacacaaaccaccctcaaacaagttc
gtccagccaccgcccacggcgaaacacgtcaatcccgcatggggccgattttccggaaat
gagtgggttacggtgatgggctgtagcgccattgtgcttttctgcccactgctagccctc
ctcgcgtgcgtttgtctgaagcatttcgatggtggtttgttaccgacgctgtgggccttc
atgacgacgcacccggtggaattcattgttaggtatgccccccggcctacggctggtgcc
tcggcagcctatgcgggctggttgttattccaggcggcgctgtatgcatggttgcccagt
cccatcgggtacggacaacgtacgcccgccggacatcttctgccgtatcgtgtgaacggt
attcacgcctgggtcgttacgcatgtggtctctgtggttgcggtttacactggcatgttg
gatccagcggtaatcgccaagaattgggaagggttgttggtcgtggcgaatgtttacggc
tatcttcttgccgtggtggcttatttgaaagcgcacctgttcccgacccatgaggcggac
agaaaattcagtggttccatggtttatgacttttacatggggatcgagttaaacccaagg
ttcggtgaatggtgggatttcaaattattccacaatgggcgaccggggatcgttgcctgg
accctgatcaacctctcattcgccgcttggcagttccaattgcacggatacatttccaac
tctatgattattgtcaacatccttcatgcattttatgtcgtggactttttcatcaacgag
gattggtatctgcgcaccattgatatctgtcatgatcattacggattttacctcgcgtgg
gggagtatggtctggttgcccggaacgtacactttgcaagcgcagtatctggcacgatac
ccggttgacctgtcgacgccggtcgcggccgcgatactcttgatcggcatctcggggtac
gtcgttttccgcagcgtgaattatcaaaaggatattgtccggagaaccaacggggagtgt
aatatatggggcaagaaggcggaggtgatacgcacgacctacaaaactgaggacggaaaa
atgcacgaatcattactcctttgctcgggatggtggggaatcgttcgtcacgcgaactac
ctgggggatttggtgctttcgtacagcggatgcgcggtgtgcggggtgcataatatcctg
ccctggtggtacgcagttttcatgacggccttgctgctccaacggtgcgtgagagatcac
tcgcggtgcttggggaaatatggggaagattgggaaaggtattgcggaagggtgaaatgg
aagttgattccgggcgtttattag

DBGET integrated database retrieval system