KEGG   Tuber melanosporum: GSTUM_00003622001Help
Entry
GSTUM_00003622001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tml  Tuber melanosporum
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:tml00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 560 aa AA seqDB search
MGSGSSKPVKNTSGNSRRSLHTASSQSTTATSKRRSIVPPRLKNGEREAFTAAIDQGTTS
SRFLIFDGSGTPRAGHQVEFEQLYPHSGWVEHDPYEILNSVNECIENATKMFFDQGYGVG
DIKALGITNQRETTVVWDTETGKPLYNAIVWPDTRTSKLVHELRRKGGSEKLQQLCGLPL
STYPSSVKLMWMLRHVPAVQSALKKDRLSFGTVDTWLLYNLTGGVKNGLHVTDPTNASRT
MFCNINTLEYDDFLIDWFGVRGVKLPKIVPSSDPDAYGSISDGALAGTKIAGCLGDQSAA
LVGQCAFTPGMAKNTYGTGCFLLYNTGYEPVLSENGLLTTVAYAFKGFKPVYALEGSIAV
AGSAVKFLRDNLGLIKESGEIGELAAKVPDTGGVVFVTAFSGLFAPYWIDDAQGTIFGIT
QYTTKEHIARATIEATCYQTKAILTAMEKDSGTALHALAVDGGMSNSDVCMQLQADIMGI
DVDRPKMRETTALGAAIAAGFAVNMWKGFDELKSVNRDDRKTFSPKTDEGTREKWFNLWG
KAVERSRGWVDNDAADEDLE
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgggtagcggttcttcaaagcccgttaagaatacaagcggaaatagccgtcggtcgtta
cacaccgcttcctctcaatcgaccacagcaacatcgaagagacggtctatagttcctccc
cgcctgaaaaatggggagcgcgaggctttcactgctgcaattgaccagggaactacgagt
tcacgttttctgatcttcgacggatccggtactccccgggctggtcaccaagtcgaattt
gaacagttatatccgcactcgggatgggttgagcatgatccatatgaaatcttaaattct
gtgaatgagtgcatagaaaacgccactaaaatgtttttcgaccaaggttatggggtgggt
gatatcaaagcattgggaatcacaaatcagcgtgaaacaactgtggtatgggataccgaa
acaggaaagccgctctacaatgccatcgtatggccggatacccgaacctcaaaattagtt
cacgaattgcgcagaaaaggaggttcagagaagctccagcaactctgtggcttgccgcta
tccacatatccatcgagtgttaagctaatgtggatgttgcgacacgttccggctgtccaa
tctgcgctcaaaaaggatcggctttcgttcgggacggttgatacctggttattatacaac
cttaccggcggcgtaaagaatggacttcatgttaccgatccaactaatgcatctaggact
atgttttgtaacatcaacacattggaatacgatgactttctaatcgattggtttggggta
aggggagtgaaactaccaaagatcgtcccatcctcagaccccgatgcatatggcagcatt
agtgatggtgctctcgctggaacaaaaattgctggctgcctcggagaccagagcgctgcc
ttggtcgggcaatgtgctttcactcccggaatggcgaagaatacttatggaactggttgt
ttcctcctctataacaccggctatgagccggtcttgtcggagaacggccttctaaccacg
gtggcctatgccttcaagggcttcaagccggtatatgccttagaaggatctatcgctgtt
gctggctcggccgtcaagtttctgcgagataacctcgggctcataaaagaatccggcgaa
ataggcgaacttgctgccaaagtacctgacacaggcggcgtcgttttcgtgacggctttc
tctggcctttttgccccgtactggattgatgatgcccagggtaccatattcggtatcaca
caatatacaaccaaggaacatattgcaagagcaaccatcgaggcaacatgctatcagaca
aaggccatcttgaccgcaatggagaaagatagtggaacggcgttgcatgcgcttgccgtt
gatgggggtatgagcaattccgatgtttgtatgcagctccaggccgacattatgggtatc
gatgttgaccggcccaaaatgcgagaaacaacggcacttggggcagcgatagcggcaggg
ttcgcagtgaacatgtggaaagggtttgatgaactcaaaagcgtcaaccgtgacgaccgc
aagacgtttagtcctaaaaccgacgagggcactagggaaaagtggtttaacctttggggc
aaagccgttgagagatcccgggggtgggtggacaacgacgctgcggatgaggacctcgag
tag

DBGET integrated database retrieval system