KEGG   Tuber melanosporum: GSTUM_00003622001Help
Entry
GSTUM_00003622001 CDS       T01282                                 

Definition
(RefSeq) hypothetical protein
  KO
K00864  glycerol kinase [EC:2.7.1.30]
Organism
tml  Tuber melanosporum
Pathway
tml00561  Glycerolipid metabolism
tml01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    GSTUM_00003622001
Enzymes [BR:tml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     GSTUM_00003622001
Exosome [BR:tml04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GSTUM_00003622001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FGGY_C FGGY_N
Motif
Other DBs
NCBI-GeneID: 9187486
NCBI-ProteinID: XP_002837355
INRA: GSTUM_00003622001
UniProt: D5GAK3
AA seq 560 aa AA seqDB search
MGSGSSKPVKNTSGNSRRSLHTASSQSTTATSKRRSIVPPRLKNGEREAFTAAIDQGTTS
SRFLIFDGSGTPRAGHQVEFEQLYPHSGWVEHDPYEILNSVNECIENATKMFFDQGYGVG
DIKALGITNQRETTVVWDTETGKPLYNAIVWPDTRTSKLVHELRRKGGSEKLQQLCGLPL
STYPSSVKLMWMLRHVPAVQSALKKDRLSFGTVDTWLLYNLTGGVKNGLHVTDPTNASRT
MFCNINTLEYDDFLIDWFGVRGVKLPKIVPSSDPDAYGSISDGALAGTKIAGCLGDQSAA
LVGQCAFTPGMAKNTYGTGCFLLYNTGYEPVLSENGLLTTVAYAFKGFKPVYALEGSIAV
AGSAVKFLRDNLGLIKESGEIGELAAKVPDTGGVVFVTAFSGLFAPYWIDDAQGTIFGIT
QYTTKEHIARATIEATCYQTKAILTAMEKDSGTALHALAVDGGMSNSDVCMQLQADIMGI
DVDRPKMRETTALGAAIAAGFAVNMWKGFDELKSVNRDDRKTFSPKTDEGTREKWFNLWG
KAVERSRGWVDNDAADEDLE
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgggtagcggttcttcaaagcccgttaagaatacaagcggaaatagccgtcggtcgtta
cacaccgcttcctctcaatcgaccacagcaacatcgaagagacggtctatagttcctccc
cgcctgaaaaatggggagcgcgaggctttcactgctgcaattgaccagggaactacgagt
tcacgttttctgatcttcgacggatccggtactccccgggctggtcaccaagtcgaattt
gaacagttatatccgcactcgggatgggttgagcatgatccatatgaaatcttaaattct
gtgaatgagtgcatagaaaacgccactaaaatgtttttcgaccaaggttatggggtgggt
gatatcaaagcattgggaatcacaaatcagcgtgaaacaactgtggtatgggataccgaa
acaggaaagccgctctacaatgccatcgtatggccggatacccgaacctcaaaattagtt
cacgaattgcgcagaaaaggaggttcagagaagctccagcaactctgtggcttgccgcta
tccacatatccatcgagtgttaagctaatgtggatgttgcgacacgttccggctgtccaa
tctgcgctcaaaaaggatcggctttcgttcgggacggttgatacctggttattatacaac
cttaccggcggcgtaaagaatggacttcatgttaccgatccaactaatgcatctaggact
atgttttgtaacatcaacacattggaatacgatgactttctaatcgattggtttggggta
aggggagtgaaactaccaaagatcgtcccatcctcagaccccgatgcatatggcagcatt
agtgatggtgctctcgctggaacaaaaattgctggctgcctcggagaccagagcgctgcc
ttggtcgggcaatgtgctttcactcccggaatggcgaagaatacttatggaactggttgt
ttcctcctctataacaccggctatgagccggtcttgtcggagaacggccttctaaccacg
gtggcctatgccttcaagggcttcaagccggtatatgccttagaaggatctatcgctgtt
gctggctcggccgtcaagtttctgcgagataacctcgggctcataaaagaatccggcgaa
ataggcgaacttgctgccaaagtacctgacacaggcggcgtcgttttcgtgacggctttc
tctggcctttttgccccgtactggattgatgatgcccagggtaccatattcggtatcaca
caatatacaaccaaggaacatattgcaagagcaaccatcgaggcaacatgctatcagaca
aaggccatcttgaccgcaatggagaaagatagtggaacggcgttgcatgcgcttgccgtt
gatgggggtatgagcaattccgatgtttgtatgcagctccaggccgacattatgggtatc
gatgttgaccggcccaaaatgcgagaaacaacggcacttggggcagcgatagcggcaggg
ttcgcagtgaacatgtggaaagggtttgatgaactcaaaagcgtcaaccgtgacgaccgc
aagacgtttagtcctaaaaccgacgagggcactagggaaaagtggtttaacctttggggc
aaagccgttgagagatcccgggggtgggtggacaacgacgctgcggatgaggacctcgag
tag

DBGET integrated database retrieval system