KEGG   Tuber melanosporum: GSTUM_00003828001Help
Entry
GSTUM_00003828001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
tml  Tuber melanosporum
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GSTUM_00003828001
Enzymes [BR:tml01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     GSTUM_00003828001
Glycosyltransferases [BR:tml01003]
 Polysaccharide
  Storage polysaccharide
   GSTUM_00003828001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 702 aa AA seqDB search
MSEAPEGRRDVKNHLLFEISTEVANRVGGIYSVIKSKAPITTAEYGERYCLIGPLNRTSA
AVEVEALEPTNPALKATLAAMSDRGIQWLYGRWLIDGAPRVLLFDTGTGYKHLDEWKGDL
WSTAGIPCPPGDAETNEAVVFGYLVAWFLGEFVSHEQSRAVIAHFHEWLAGVALPLCRKR
RIDVTTIFTTHATLLGRYLCAGSVDFYNNLQYFDVDAEAGKRGIYHRYCIERAATHSCDV
FTTVSHITAYESEHLLKRKPDGVLPNGLNVVKFSAMHEFQNLHAQSKEKIHDFIRGHFYG
HNDFDLENTLYFFTAGRYEYRNKGVDMFIESLARLNHRLKISGSKTTVVAFIIMPAQTHS
LTVEALKGQAVIKALRDTVDNIEKGIGKRLFERALRWHDGEQVPAEKDLMSNQEKVMLKR
RVYALKRNALPPIVTHNMIDDQADPILNQIRRVQLFNHPSDRVKIVFHPEFLNSSNPVLS
LDYDDFVRGTHLGVFASYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIENASDYGI
YIVDRRMKGVDDSVNQLCQFMYDFTVKSRRQRINQRNRTERLSDLLDWKRMGMEYVKARQ
LALRRAYPGSFDSKEPFPFFDGTEQKVSRPLSAPGSPRDRSGMMTPGDFPSLQEGMEGLN
TDDYVGWRLPEEEDPDDYHFPLTLRAPLTKRQQPSVNGEHNS
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaggcaccggaaggcagaagagatgtcaagaaccaccttctgttcgagatttct
acagaggttgcaaaccgggttggcggtatctattccgtcataaagtctaaagcgccaatc
actactgctgagtatggcgagcgttactgccttatcggccccctcaaccgtacttctgct
gcggttgaagttgaagctcttgagccgaccaatccggcactaaaggccaccctcgctgct
atgagtgatcgaggaattcaatggctgtacggtagatggcttattgacggtgccccaagg
gtgcttctttttgatacaggtactgggtataagcacttggacgaatggaagggggatctg
tggagtacagccgggatcccatgcccaccgggcgatgccgagaccaatgaggctgtcgtg
tttggctacctagttgcctggttccttggagagttcgtcagccacgagcaatcccgtgca
gttattgcgcatttccatgagtggctcgccggtgtggctctccccctttgccgcaagcga
agaattgatgttacaactatcttcacaactcacgctacactgctcggaagatacttgtgc
gctggatccgttgatttctacaacaaccttcagtatttcgatgtggatgctgaagcgggc
aagagagggatctaccaccgttactgtatcgagcgtgcagcaacccattcttgtgatgtc
ttcactacagtttctcatatcacggcttacgagagcgagcacctgctcaaacgcaaaccg
gatggcgttttgcccaatggattgaacgttgtaaagttttcggcgatgcacgagtttcaa
aatctccatgcccagtccaaggaaaagattcatgattttataaggggtcatttttatggt
cataacgattttgatctagaaaatactctctacttcttcacagcagggcgttatgagtat
cgcaataagggggttgacatgttcattgaatcgctagctcggttgaaccaccgtctgaag
atctctgggtcaaagaccaccgtcgttgcattcattatcatgccggctcagacacactct
ctaactgttgaagctttgaaaggccaggctgttatcaaagcactgcgggacactgtggat
aacattgagaaagggattgggaagaggctgtttgagcgtgcgttgaggtggcatgatgga
gaacaagttccggctgagaaggacctcatgagcaatcaagaaaaagtcatgctgaaacgg
cgagtgtatgctctgaagcgaaatgctcttccaccgattgtcacgcacaacatgattgat
gaccaagccgaccctattcttaaccaaatccggagggtacaactgttcaaccatccctcc
gatcgagttaagatcgttttccatcccgagtttttgaattcatcgaaccccgttttgtcg
cttgactacgatgactttgttcgcgggacccatcttggagtttttgcatcctactacgaa
ccttggggttatactcctgccgaatgcactgtcatgggtgtaccgtcgatcacgaccaat
ctttctggttttgggtgctacatggaagaattgatcgaaaatgcatctgactatggtatc
tacattgtggaccgccgaatgaagggagtcgatgacagcgtcaaccagctttgccagttc
atgtacgattttactgttaaaagcaggaggcagaggatcaaccaaaggaatagaactgag
cgattaagtgatctcttggactggaagaggatgggcatggaatatgttaaggcaaggcaa
ttagccttgagaagagcctaccccggttcgttcgattctaaggaaccattcccattcttc
gacggtacggaacaaaaggtttcacgtcccttgtctgctcctggctccccaagagaccgc
tccggcatgatgacccctggagatttcccgtcattgcaggaaggaatggaaggattgaat
acagatgattacgttggttggagattgcccgaggaggaggatcctgatgattatcacttc
cccttgaccctcagagcacctcttaccaagagacaacagccatctgttaatggcgaacat
aacagctag

DBGET integrated database retrieval system