KEGG   Tuber melanosporum: GSTUM_00003903001Help
Entry
GSTUM_00003903001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
tml  Tuber melanosporum
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GSTUM_00003903001
Enzymes [BR:tml01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     GSTUM_00003903001
Peptidases [BR:tml01002]
 Cysteine Peptidases
  Family C44
   GSTUM_00003903001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 541 aa AA seqDB search
MCGIFACHKHPDVHKFKPQALQLAKAVRHRGPDWSGNIISNNTILTHERLSIVGIDSGAQ
PLVSDDGTIFLAVNGEIYNHRILRKQLKPEVTFRTHSDCEVILHLYPNHGINTPKLLDGM
FSFVLYDSKNDRTIAARDPIGITSFYQGWSSKTPGAVYFASELKCLHPVCDKIVSFPPGH
IYDSLTKKTTRYFEPSWWDPKMVPFHPVDYKLIRTTLEKSVRKRLMAEVPYGVLLSGGLD
SSLIASIAAHDSTVTALPELHSFSIGLSGSPDTIAAKRVAKFLGTVHHEFNFTLQEGLDA
LRDVIYHLESYDVTTIRASTPMYLLSRKIKALGVKMVLSGEGSDEIFGGYLYFVNAPSKD
GFHAENIRRVKNLHLSDCLRANKSTAAWGVEARVPFLDKQFLEVSLNVDPAEKLITKERI
EKFILRKAFDTSDDPDAKPYLPDDILWRQKEQFSDGVGYGWIDILKDTAEKMVSDEQMKS
PKPEWGADVPDSKEGYWYRCMFDEQFPAQCAPTVMRWTPMWTKVTDPSGRAISIHVAKYD
Q
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtatattcgcttgccacaagcatcccgatgttcacaaattcaagcctcaagct
ttgcaattggctaaggccgttcgccatcgcggtccggattggagcgggaacattatttcc
aacaacacgatccttactcatgagcggttgagtattgtcggaatcgacagtggggctcag
ccattggtcagcgatgatggtactatatttttggcagtcaacggtgaaatttacaaccac
agaatcttgcgcaagcaactcaagcctgaagtgacattcaggacacattccgactgtgag
gttatcttgcacttgtaccctaaccatggaataaacacccccaagcttctcgacggaatg
ttctcttttgtcctctatgactcaaagaacgatcgcaccatcgcagctcgtgatcccatt
ggaattaccagtttctaccagggctggtcctccaagactcccggcgccgtttacttcgcc
tcggaactcaaatgcctccacccagtttgcgacaaaattgtctcgttccctcccggtcac
atttatgactccctcacgaagaagacgaccagatatttcgagccttcatggtgggacccc
aaaatggttccattccacccagtggattacaaacttatcaggaccacacttgagaagtcc
gttagaaaacgtttgatggccgaggtcccttacggtgttcttctctctggtggcctcgat
tccagtcttatcgcctccatcgctgcgcacgattctaccgttacagccctgccggaattg
cattccttctccattggtctttctggttcccctgataccattgcggcgaagagagtcgcg
aagttccttggaactgtccaccatgagttcaactttaccctacaggagggtcttgatgct
cttagagatgtcatttaccaccttgagagttatgatgtgaccactattcgcgcttcaaca
cctatgtatctgttgagcaggaagatcaaagccttgggtgtgaagatggttcttagtggt
gaaggttctgacgagattttcggtggttatctgtatttcgtcaatgcccctagcaaagac
gggttccatgccgagaatatcaggagagtcaagaaccttcatctctctgattgcctccgt
gcgaacaagtctactgccgcctggggggttgaggctcgtgttcccttcttggataagcag
ttccttgaggtttctctcaatgtggatcccgccgagaagcttatcactaaggagcgcatt
gagaagttcatcctgagaaaggcgttcgatactagcgacgacccagatgctaagccttac
cttcccgacgatattctctggcgtcagaaggagcaattcagcgatggtgttggctacgga
tggattgatatactcaaggacaccgccgaaaagatggtctcggacgagcaaatgaagagt
cccaagcccgaatggggagccgacgtccctgatagcaaggaggggtactggtacagatgc
atgtttgatgagcagttccctgcccaatgtgccccaaccgtcatgcgttggaccccaatg
tggaccaaagtcactgatcccagtggaagagccatctctatccacgttgcgaaatacgac
caatag

DBGET integrated database retrieval system