KEGG   Tuber melanosporum: GSTUM_00003970001Help
Entry
GSTUM_00003970001 CDS       T01282                                 

Definition
(RefSeq) hypothetical protein
  KO
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
tml  Tuber melanosporum
Brite
Enzymes [BR:tml01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     GSTUM_00003970001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 284 aa AA seqDB search
MIGFLRSGGLFPLTRDAWQLLLRCWKYFPLVAPLQLALPEFYPAGKTSYPSIFNVPGKPG
WIFMELFSPLTLLYTIYTNPERTGELPKTHVWLTTLYCIHYLYRALLSPIRNPSMGPMNI
GMVCAGVSFNIINGSAIGGWLGGYGSAADVPGWQISIGSAMFILGLWGNMYHEEILREIR
RDKSFDKDAEKEGRVVTSNERVYKIPEGGLFKWVWNPHYFSEWIEWSGFAIAGGGFANFL
PATLFVANELATMLPRAIQQKRWYGEKFNKDVLPYRKAAIPGII
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgataggtttcctacgctctggagggctttttcctctcactagggatgcgtggcaactt
ctcttgaggtgttggaagtattttcccctggtcgcgccacttcagttggctctcccggag
ttctatcctgccggaaaaacctcgtacccttccatcttcaacgtacccggaaaaccggga
tggattttcatggagctcttctctccgctcacactattatacacaatctataccaatcct
gagcgtaccggcgagcttccaaaaactcatgtctggcttactactctgtactgcattcac
tacctctaccgagcacttctcagccctatacgaaacccgtcgatgggacccatgaacatc
ggcatggtttgcgcgggagtttcgttcaacatcataaacggttccgcaattggcggctgg
ctgggtggttatggttccgccgcagatgtccctggctggcagatttcgatcggaagcgcc
atgtttattctggggctctgggggaacatgtaccacgaagagatcctacgagaaatcaga
agagacaaatctttcgacaaggatgctgaaaaggagggtagagtggtaacgagcaatgag
agagtctataagatccccgaaggcggtctatttaaatgggtttggaacccgcattacttc
tctgaatggattgagtggagtggattcgcaattgctggaggagggttcgccaactttctt
cctgccacactatttgtggccaacgaactcgctaccatgctcccaagggcgatccaacaa
aagcggtggtacggggaaaagtttaacaaagacgttctcccatacagaaaggcggctatc
ccgggtatcatataa

DBGET integrated database retrieval system