KEGG   Tuber melanosporum: GSTUM_00004421001Help
Entry
GSTUM_00004421001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
tml  Tuber melanosporum
Brite
Exosome [BR:tml04147]
 Exosomal proteins
  Proteins found in most exosomes
   GSTUM_00004421001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 130 aa AA seqDB search
MSWQAYVDSTLLGSGKVNAAAIFSAAGDSVWATSAGFAVMPEEIKLLATAFGDGSKVPEL
PSPGFHIGGVKYITIKCEEKKIYGKQGKTGIVCARTTQAILVAYYGEDIQPGQAASTVEA
LAEYLRGVGY
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgagttggcaagcatatgttgactcgaccctcttgggttctgggaaagttaatgcagcc
gctatcttcagcgctgcaggagacagtgtgtgggctacttccgccggttttgcggtcatg
ccagaagagatcaaactactcgccacagcattcggggatggcagcaaggtgcctgaactc
cccagtccaggatttcacattgggggggtaaagtacatcaccatcaagtgtgaagaaaaa
aaaatctacggaaaacagggaaaaactggcatcgtttgtgctagaacaacacaagccatc
ctcgttgcttactacggcgaggatatccaacccggacaggcagcgagcacagttgaagcc
ctcgccgaatacctacgcggggtggggtactga

DBGET integrated database retrieval system