KEGG   Tuber melanosporum: GSTUM_00004503001Help
Entry
GSTUM_00004503001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
tml  Tuber melanosporum
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    GSTUM_00004503001
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    GSTUM_00004503001
Enzymes [BR:tml01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     GSTUM_00004503001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 301 aa AA seqDB search
MSELSAARYGKDNIRLCKVHRDEGTNIHTVTEMTVCVLVEGDINSSYTRADNSVVVATDS
MKNTVYLLAKQYPVTPPELFGSILASHFIELYPHIHVTRVKVVTHRWTRMTIDGEPHPHS
FLRDGAETRNAEVVCKRGTGIFVKSGIQGLLVLKSTGSAFYGFIKNDYTSLGETSDRILS
TEVDANWEWGLFNTLGDVERNIPLFDMGWESARNITLQTFAKDNSVSVQATMYKMANKIL
EAVPEVNNVDYSLPNKHYFEIDMKWHNEVKNTGKDAEVYAPQSDPNGLIKCTVSRTKTSK
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagttgtctgcagctcgatatgggaaggataacattcgtctctgcaaagttcac
cgtgatgaaggtacaaacattcatactgtcactgaaatgaccgtctgtgtacttgtggag
ggagatatcaactcctcgtacacacgcgcagacaatagcgtcgtcgtagctacagactca
atgaagaacactgtttacttgctcgccaagcagtacccagtaactccaccagaacttttt
ggctcaattcttgcctcccactttatcgaactatatccccatattcacgttacccgtgta
aaggttgtcacgcaccgatggacgcgtatgacaatcgacggcgagccgcacccgcactcg
ttccttcgggacggcgcagagactcgcaacgctgaggttgtttgcaagcgagggacaggt
attttcgtgaagtcagggatccagggattgctggtcctcaaaagcaccggttcggctttc
tacggcttcattaagaacgattatacctctttgggtgaaacctctgatcgcattctcagc
acagaggtggatgccaattgggaatggggcttattcaacacattgggtgacgtagagaga
aatatccctcttttcgacatgggttgggaatccgcacgaaatatcactcttcaaacattc
gcaaaagacaacagcgtgagcgtccaggctaccatgtataaaatggccaacaagatactt
gaagctgttcccgaggtgaataacgttgattactccttgccgaacaaacattactttgag
attgatatgaaatggcacaatgaggtcaagaataccggtaaggatgccgaggtatatgca
cctcaatccgatcccaatggtttgatcaaatgcacagtctctagaaccaagacctcaaag
ctctag

DBGET integrated database retrieval system