KEGG   Tuber melanosporum: GSTUM_00004661001Help
Entry
GSTUM_00004661001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
tml  Tuber melanosporum
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GSTUM_00004661001
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    GSTUM_00004661001
Enzymes [BR:tml01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     GSTUM_00004661001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 542 aa AA seqDB search
MLSTHPPKSEDEDAIFAAGVEEVKKWWAEPRWKGIVRPYSTEDIVSKRGTLKQHYPSSQT
ARKLFELLNERAAQGLPVHTMGAIDPVQMTQQAPHLEALYVSGWACSSVLTTTNEVSPDL
GDYPYNTVPNQVQRLFKAQQLHDRKHYDERRSMTPQQRKEKPWVDYLRPIIADGDTGHGG
LSAVMKLAKLFAENGAAAIHLEDQMHGGKKCGHLSGKVLVPISEHINRLIATRFQWDLMG
VENLLIARTDSESGKLISSTVDTRDHQFILGTTAQTTPLSEVLQNLESTGAPTEALERAE
AAWFARHELTTFDDAVKSELAKLPNAQAKMEEYMQHASTRSNTVAREHARALLGHEIFFS
WDLPRTREGYYHYSAGLPAAIKRAQAFAPYSDLLWLETKRPSLTQATSFARTLLRTPSSP
SAGKHLVYNLSPSFNWLAEGFTPEQLKSFIWDLAKEGFVLQIVSLAGLHSGALATCKLAT
RFKDEGMLAYVDLVQRREKEIGCDVLTHQKWSGANYLDGVLQAVASSSATSAVGGDSTEH
GF
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgctctcaacacaccctccgaagtcggaagacgaggacgcgatattcgctgccggggtc
gaggaggtgaaaaagtggtgggcggaaccccgatggaaagggattgttcggccctactct
accgaggacattgttagcaagcgaggcacgctgaagcagcattacccgagctcgcagacg
gccaggaagttgtttgagttgctgaatgagcgggcggcgcaggggttgccggtgcatact
atgggcgctattgatcccgtacaaatgacccagcaagcaccgcatcttgaagcgctatac
gtgagcgggtgggcttgttctagtgttctcacaaccacgaatgaggtatcaccggacctt
ggggattacccgtacaataccgtaccgaatcaagtccaacgactattcaaagcccagcaa
ctccacgaccgaaagcactatgacgaacgccggagcatgacaccacagcagcgcaaggag
aaaccgtgggtagactacctccgcccgataatcgcggacggggacacgggacatggtgga
ctatccgctgtgatgaagctggcgaagctcttcgccgagaatggggccgcagcgatacac
ctggaggaccagatgcacggtggcaagaagtgcgggcacctgtcgggcaaagtcctcgtg
cccatcagcgagcatatcaaccgactcatcgcgacgcgcttccagtgggacctgatgggc
gtggagaacctcttgatcgcgcgaacggacagtgagagtggaaagctcatcagcagcacc
gtcgacacccgcgaccaccaattcatcctaggcacaaccgcccagaccactcctctcagc
gaagtcctccaaaacctcgaatccaccggcgccccgacagaagccctggaaagggcggag
gcagcctggttcgcacggcacgaattgacgaccttcgatgatgccgtcaagtccgaactc
gccaagctccccaacgcccaggccaagatggaagaatacatgcagcacgcatcaacccgc
agcaacactgtcgcgcgggaacacgcgcgcgcacttctcggccacgagatattcttctcc
tgggacctccctcgcacgcgggaaggctactaccattactccgccggcctccccgctgcc
ataaagcgcgcacaggccttcgcaccctactccgacctcctctggctggagaccaaacgt
ccatcgctcacgcaagcaacatccttcgcccgcaccctcctgcgcaccccttcctccccg
tccgcaggcaaacacctagtctacaacctctcgcccagcttcaattggctagcggagggc
ttcactccggagcagttgaagtccttcatctgggacttggcgaaggagggcttcgtgttg
caaatcgtgtccctcgcaggattacactcgggtgccctcgctacctgcaaactcgccacg
cggttcaaagatgagggcatgctcgcgtacgtcgacctcgtgcagaggcgcgagaaggag
attgggtgcgacgtgctcacgcatcagaaatggagtggagcgaattacttggatggggtg
ttgcaggccgtggctagctcctcagcgaccagcgcggttgggggggatagcactgagcat
ggattttag

DBGET integrated database retrieval system