KEGG   Tuber melanosporum: GSTUM_00004831001Help
Entry
GSTUM_00004831001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
tml  Tuber melanosporum
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    GSTUM_00004831001
Enzymes [BR:tml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     GSTUM_00004831001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 452 aa AA seqDB search
MYAPPSDDDRPSGRHHLSKGASRGRSGTDASKKGEKGSALRRKPSAAGTRGPVLKRRKSS
PSWGIKKDLSMVDRIAAFFVENQIRFSAIILAIMHGCHYLVPQLRPTTRKLLEVCYYNPV
TGNYGKGPDDVYLVFYWIVMFTFLRATAVDYIFMPFARRGGISAKKDLVRFAEQAWLLVY
YSIFWTLGMYLMYNSPYWMDLAQMWVDWPVRELGGTFKWYYLVQYAFWLQQIFVLNIEER
RKDYHQMFAHHIVTCMLIFASYTYHMTRVGNVILCVMDVVDILLPLAKMLKYLGYNAICD
CAFGVFLITWFIGRHVCYMRIVHSSWVDALTHIREGWYAPNPMGTVVFTKEILGTFVILL
LALQVLTLMWFYMILRVAWKVIKGGGADDTRSDDEDDGEEEEEEDIEFEGPNPKAVEAVQ
MNGASMSTASFPSVIMNGGSHRHLSSQPLGGG
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgtatgcacccccgtccgatgatgatcgacccagtggtcgccatcacttatccaaaggt
gccagtagaggcagatcaggaacggatgctagcaaaaagggagaaaagggatctgccctc
cgacggaagccatctgctgcaggtacccggggaccggttttgaagcgaaggaagagctcc
ccatcatggggtattaagaaagatctcagcatggttgatcgcattgcggcattttttgtt
gagaatcaaataaggttttccgcaattatcttggccattatgcacggttgccattatctc
gtcccacagcttcggcctacaacccggaagctattagaagtctgctactacaaccccgtc
acagggaactatgggaagggcccggacgacgtatacctggtgttctattggatagtgatg
ttcacttttttgcgtgcaaccgccgtagattatatcttcatgccgttcgcaagacgtggt
gggatatcagccaagaaggatcttgtcagatttgcagagcaagcttggcttcttgtctat
tactccattttctggacgctaggaatgtacttaatgtacaatagtccctattggatggac
cttgctcagatgtgggtggactggcctgtgcgcgagcttggtggtaccttcaagtggtat
tacctggtccagtatgcgttttggctgcagcaaattttcgtcctaaatattgaggagcgg
agaaaggactaccatcagatgtttgcgcatcatattgtgacttgcatgctgatctttgcg
agttacacataccacatgaccagagttggcaacgttatcctttgtgttatggatgtagtt
gatattctacttccgcttgccaagatgcttaagtacttgggctataatgctatttgtgat
tgtgcttttggggtcttcctcatcacctggttcatcggcagacatgtctgctatatgcgt
attgtccactcttcatgggtagatgcactcacccatatccgtgaaggatggtacgccccc
aatcctatgggaactgtggttttcactaaggagattcttggaacatttgtcattcttcta
ctcgcgctgcaagtgctcacgctcatgtggttctatatgattttacgtgtagcttggaag
gttattaagggaggaggagcagatgatactaggagtgatgatgaggacgatggggaggag
gaggaggaggaagatattgaatttgaaggtccaaaccctaaggctgtggaggctgttcag
atgaatggcgcatctatgtcgacagcctcatttccatccgttatcatgaatgggggttct
caccggcatctttcttcacagccactaggtggcggataa

DBGET integrated database retrieval system