KEGG   Tuber melanosporum: GSTUM_00005092001Help
Entry
GSTUM_00005092001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
tml  Tuber melanosporum
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Peroxisome
Class
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:tml00630]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:tml00380]
Cellular Processes; Transport and catabolism; Peroxisome [PATH:tml04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 756 aa AA seqDB search
MTGVFQRLQESLNEAKIAAAHKVNEVASTNEKIVEMWPNKVSVEKSGNRLTTDSGTGVYD
VDHWLKVVDPSTGHHGPSLLEDQIARERIHRFDHERIPERVVHARGAGAHGYFNLHTPIP
EFSSATVLNDTGRSTPIFARMSTVAGSRGSADTVRDVRGFALKFYTEEGNWDIVGNNIPV
FFIQDAIKFPDFVHAVKPEPHNEVPQAQTAHNNFWDFMYMHSESTHMSIWAMSDRGIPRS
YRMMQGFGVNTFSLINAQGERTFVKFVWTPELGVHSLVWDEALKLAGQDPDFHRKDLYEA
IENGYYPKWQFGIQTIAEKDQDKFEFDILDATKVWPEDLVPINYIGELVLNRNVDEFFAE
TEQAAFCTSHVVPGIGFSDDPLLQGRNFSYFDTQITRLGINWEQLPINRPVCPIMNFNRD
GALNHRIHKGKVNYWPNRFEAVPPASHKQETDSYQECAAKVAGLKLRVNGAKFREHFAQA
QLFYNSLAKHEKKHVEAALAFELSHCDEPIVYKRMSERLADIDLTLAQNVAKMVGGDIPK
EGRLNHGRKAPGLSQADLPAVKPSIKSRRVAMIVADGFEMGVFTAVRAALKAEGATTWVI
APRRGMIFPAGVHPESGTGGLLADHHLEGQRSTMFDAIFVCPGTRSTLTLRENGRAVHWV
REAFGHLKPIGVLGDAVSFLQQAVVLPGVDVAADPNSHDVVTSYGVVTGWRCSVGVLRSL
KIEPSTCAFSSAFAYEISKHRCWARELDGLHTKLAF
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcgtattccaaaggctgcaggagtctctgaatgaggcgaagatcgcagcagcc
cacaaagtcaacgaggtggcctcgacgaacgagaagatcgtagagatgtggccgaataag
gtctctgtcgaaaagagcgggaacagacttactacggattccggtacgggtgtgtatgat
gtggaccattggctcaaggtggttgacccgagcactggccatcacgggccgagtttgttg
gaggaccagattgcgagggagaggatccaccggttcgaccatgagcgcattcctgagcgt
gtagtccacgcccgcggagccggggcacacggatactttaacctgcacacgccaatccca
gagttctccagcgctacagtcctcaacgatacagggcgcagcactcctatattcgcccgc
atgtcaacggtagccgggtcccgtggttctgcagatacggtccgcgacgtccgcggcttt
gccctaaagttctataccgaggagggcaactgggatatcgttgggaacaacatccccgtc
ttctttatccaggatgccatcaagttcccagactttgttcacgccgttaaacccgagccg
cataatgaggtgccgcaggcgcagactgctcacaacaacttttgggactttatgtacatg
catagcgagtcaacacatatgtccatttgggccatgagtgatagggggatccctaggagt
tataggatgatgcaggggtttggggttaatacgttttcattgatcaatgctcagggtgag
agaacgtttgtcaagtttgtgtggacgcctgagttgggtgttcattcactggtctgggat
gaggctttgaagctggctggccaggatccagatttccacaggaaggacctgtacgaggcc
atcgagaacggatactatcctaagtggcaattcggaattcaaactatcgctgagaaggat
caggataagtttgagttcgatatcctggacgctacaaaggtgtggccggaggatctagtt
cctatcaactatatcggagagctagttctaaacagaaatgtcgacgagtttttcgccgaa
accgaacaggcagccttctgcacctctcacgtcgtgcccgggatcggcttttcggatgac
cctctcttgcaagggagaaacttcagttacttcgatacgcaaatcacccgcttgggaatc
aactgggaacaactccctatcaaccgccccgtctgtcccatcatgaacttcaaccgcgac
ggagcacttaaccaccgcatccacaagggcaaagtcaactactggccaaaccgcttcgaa
gccgtcccccccgcgtcgcacaagcaggagacagactcgtaccaggagtgcgctgccaag
gtcgcgggattgaaactcagggtaaatggagcgaagttccgtgagcactttgctcaggca
caattgttttataattctctcgcgaagcacgagaagaaacatgttgaagctgcgcttgca
tttgagctgagccattgcgacgagccaatcgtgtacaagaggatgtcggagagacttgct
gatatcgacctcaccctcgcccaaaacgtcgccaagatggtcggcggtgacatcccgaag
gagggccgcctgaaccacggtcgcaaagctccgggtctatcacaggccgatttacccgct
gtcaagccaagcatcaaaagccgtcgggtggcaatgatcgttgcggacggcttcgaaatg
ggtgttttcaccgcggtacgcgcagcgcttaaggcggagggcgcaacgacctgggtgatt
gctcctagaagaggaatgatcttccctgccggtgtccacccagaaagcggcacgggcggc
ctcctggcagaccaccacctcgagggacagaggagtaccatgtttgacgcgatatttgtg
tgtcccggcacacggagcacgctcactctccgagagaacggaagagcagtccactgggtc
cgcgaggccttcggccacttgaagcccatcggcgtcctcggtgatgcggtgtccttcctg
caacaagccgttgtcctccccggcgtagacgtagcggccgaccccaactctcacgatgtt
gttacctcctacggcgtcgtaacgggctggaggtgttccgtgggcgtactccggagcctc
aagatcgagcccagcacctgcgcgttttcgagcgctttcgcgtacgagatttcgaagcat
agatgctgggccagggagttggatgggctccacacaaagcttgcgttttaa

DBGET integrated database retrieval system