KEGG   Tuber melanosporum: GSTUM_00005092001Help
Entry
GSTUM_00005092001 CDS       T01282                                 

Definition
(RefSeq) hypothetical protein
  KO
K03781  catalase [EC:1.11.1.6]
Organism
tml  Tuber melanosporum
Pathway
tml00380  Tryptophan metabolism
tml00630  Glyoxylate and dicarboxylate metabolism
tml01110  Biosynthesis of secondary metabolites
tml01130  Biosynthesis of antibiotics
tml01200  Carbon metabolism
tml04011  MAPK signaling pathway - yeast
tml04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    GSTUM_00005092001
  Amino acid metabolism
   00380 Tryptophan metabolism
    GSTUM_00005092001
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    GSTUM_00005092001
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    GSTUM_00005092001
Enzymes [BR:tml01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     GSTUM_00005092001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Catalase Catalase-rel DJ-1_PfpI
Motif
Other DBs
NCBI-GeneID: 9188542
NCBI-ProteinID: XP_002837108
INRA: GSTUM_00005092001
UniProt: D5G9V6
AA seq 756 aa AA seqDB search
MTGVFQRLQESLNEAKIAAAHKVNEVASTNEKIVEMWPNKVSVEKSGNRLTTDSGTGVYD
VDHWLKVVDPSTGHHGPSLLEDQIARERIHRFDHERIPERVVHARGAGAHGYFNLHTPIP
EFSSATVLNDTGRSTPIFARMSTVAGSRGSADTVRDVRGFALKFYTEEGNWDIVGNNIPV
FFIQDAIKFPDFVHAVKPEPHNEVPQAQTAHNNFWDFMYMHSESTHMSIWAMSDRGIPRS
YRMMQGFGVNTFSLINAQGERTFVKFVWTPELGVHSLVWDEALKLAGQDPDFHRKDLYEA
IENGYYPKWQFGIQTIAEKDQDKFEFDILDATKVWPEDLVPINYIGELVLNRNVDEFFAE
TEQAAFCTSHVVPGIGFSDDPLLQGRNFSYFDTQITRLGINWEQLPINRPVCPIMNFNRD
GALNHRIHKGKVNYWPNRFEAVPPASHKQETDSYQECAAKVAGLKLRVNGAKFREHFAQA
QLFYNSLAKHEKKHVEAALAFELSHCDEPIVYKRMSERLADIDLTLAQNVAKMVGGDIPK
EGRLNHGRKAPGLSQADLPAVKPSIKSRRVAMIVADGFEMGVFTAVRAALKAEGATTWVI
APRRGMIFPAGVHPESGTGGLLADHHLEGQRSTMFDAIFVCPGTRSTLTLRENGRAVHWV
REAFGHLKPIGVLGDAVSFLQQAVVLPGVDVAADPNSHDVVTSYGVVTGWRCSVGVLRSL
KIEPSTCAFSSAFAYEISKHRCWARELDGLHTKLAF
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcgtattccaaaggctgcaggagtctctgaatgaggcgaagatcgcagcagcc
cacaaagtcaacgaggtggcctcgacgaacgagaagatcgtagagatgtggccgaataag
gtctctgtcgaaaagagcgggaacagacttactacggattccggtacgggtgtgtatgat
gtggaccattggctcaaggtggttgacccgagcactggccatcacgggccgagtttgttg
gaggaccagattgcgagggagaggatccaccggttcgaccatgagcgcattcctgagcgt
gtagtccacgcccgcggagccggggcacacggatactttaacctgcacacgccaatccca
gagttctccagcgctacagtcctcaacgatacagggcgcagcactcctatattcgcccgc
atgtcaacggtagccgggtcccgtggttctgcagatacggtccgcgacgtccgcggcttt
gccctaaagttctataccgaggagggcaactgggatatcgttgggaacaacatccccgtc
ttctttatccaggatgccatcaagttcccagactttgttcacgccgttaaacccgagccg
cataatgaggtgccgcaggcgcagactgctcacaacaacttttgggactttatgtacatg
catagcgagtcaacacatatgtccatttgggccatgagtgatagggggatccctaggagt
tataggatgatgcaggggtttggggttaatacgttttcattgatcaatgctcagggtgag
agaacgtttgtcaagtttgtgtggacgcctgagttgggtgttcattcactggtctgggat
gaggctttgaagctggctggccaggatccagatttccacaggaaggacctgtacgaggcc
atcgagaacggatactatcctaagtggcaattcggaattcaaactatcgctgagaaggat
caggataagtttgagttcgatatcctggacgctacaaaggtgtggccggaggatctagtt
cctatcaactatatcggagagctagttctaaacagaaatgtcgacgagtttttcgccgaa
accgaacaggcagccttctgcacctctcacgtcgtgcccgggatcggcttttcggatgac
cctctcttgcaagggagaaacttcagttacttcgatacgcaaatcacccgcttgggaatc
aactgggaacaactccctatcaaccgccccgtctgtcccatcatgaacttcaaccgcgac
ggagcacttaaccaccgcatccacaagggcaaagtcaactactggccaaaccgcttcgaa
gccgtcccccccgcgtcgcacaagcaggagacagactcgtaccaggagtgcgctgccaag
gtcgcgggattgaaactcagggtaaatggagcgaagttccgtgagcactttgctcaggca
caattgttttataattctctcgcgaagcacgagaagaaacatgttgaagctgcgcttgca
tttgagctgagccattgcgacgagccaatcgtgtacaagaggatgtcggagagacttgct
gatatcgacctcaccctcgcccaaaacgtcgccaagatggtcggcggtgacatcccgaag
gagggccgcctgaaccacggtcgcaaagctccgggtctatcacaggccgatttacccgct
gtcaagccaagcatcaaaagccgtcgggtggcaatgatcgttgcggacggcttcgaaatg
ggtgttttcaccgcggtacgcgcagcgcttaaggcggagggcgcaacgacctgggtgatt
gctcctagaagaggaatgatcttccctgccggtgtccacccagaaagcggcacgggcggc
ctcctggcagaccaccacctcgagggacagaggagtaccatgtttgacgcgatatttgtg
tgtcccggcacacggagcacgctcactctccgagagaacggaagagcagtccactgggtc
cgcgaggccttcggccacttgaagcccatcggcgtcctcggtgatgcggtgtccttcctg
caacaagccgttgtcctccccggcgtagacgtagcggccgaccccaactctcacgatgtt
gttacctcctacggcgtcgtaacgggctggaggtgttccgtgggcgtactccggagcctc
aagatcgagcccagcacctgcgcgttttcgagcgctttcgcgtacgagatttcgaagcat
agatgctgggccagggagttggatgggctccacacaaagcttgcgttttaa

DBGET integrated database retrieval system