KEGG   Tuber melanosporum: GSTUM_00005119001Help
Entry
GSTUM_00005119001 CDS       T01282                                 

Definition
(RefSeq) hypothetical protein
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
tml  Tuber melanosporum
Pathway
tml00520  Amino sugar and nucleotide sugar metabolism
tml00531  Glycosaminoglycan degradation
tml01100  Metabolic pathways
tml01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    GSTUM_00005119001
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    GSTUM_00005119001
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    GSTUM_00005119001
Enzymes [BR:tml01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     GSTUM_00005119001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_3 Acetyltransf_1 Acetyltransf_7 FR47 Acetyltransf_10
Motif
Other DBs
NCBI-GeneID: 9187097
NCBI-ProteinID: XP_002837208
INRA: GSTUM_00005119001
UniProt: D5GAE2
AA seq 889 aa AA seqDB search
MMTANPAQPRMSPSGSLQLDDETLRLVGQMVMVGFEGLTVTPDIRMMIEKYYVGNILLTR
RNIRDGVQLARLTQDLQNIAQSTGFQRPLIIGIYQENGMISRLGDGIRGTHFPGAMALGA
TRSPSQAFDVAKATAKELVAVGINWNFAPLLDVISESNSSVIGVRAFGDDPQVVGRYGVA
FAEGLRAGGIGHCAKHFPGTGQITNKDGSRSSTFNFKTRDELGVNELIPFRRAVSAGLDS
VMLTSSIWGESLLGDGGTTVPADAKHIIHEVLRRQLGYDGLTVCDVTDMPGYGRGLDVRE
AAVIAVKAGCDMLQIYDKPEAQRKAIEAVYEAIGTEKIARSDIYRSSRRALQLKEHYLSW
RTALAAPDPQRLSSLMQEHQALARTVYENSITVVRDEKSLLPLSSRIRSTDNILLLTPVV
RPLYHRGPDELPIDPFECLGRALARHHPKVRHAPYTVRGITSTHVALIRRAAAVIFVAAS
ANRPNTNSQLETAGAVHRLCLNKPLVTLAACDPYELLTDRTFGTYICTYEYSPMALETAA
AVIFGERHASGSLPISIPGTPALRQQRLWFVEVWEKRRDLFASADLWRDCLGRKWPLDAS
TLSALLDRPGYSKHFVVRRAMTNELLGLVATYTVMAGPSQLVGSLALLIVRPSHRNLGIG
LSLHEVAVRHLSKQQGISSLQLGSIFPRLFPGLPVDLPSEDLSWFAHRGWKLEDKFLYDL
YMQIDTWSIPEGGMPPLYEKGVSFSCCNADQFDALIEFEEKNFGTYLGWVDKYQALKATD
DIADAMIAYTSQEIVGAALIFSPVGNNQISKDIPWPKMIGERVGGIACMGVKAECRGQGV
GLGLICASIMELKQRGLRGCFVDWADFEGTYKELGFSQWGKYREIWRNV
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atgatgacggccaatcctgcgcaacctcgtatgagcccttctgggtcgctacagcttgac
gatgaaactctacggcttgtagggcaaatggttatggtaggattcgaagggctcacagta
acccctgatatccggatgatgattgagaaatattatgttggaaacatactgttaacacgg
cggaacattcgagatggtgttcaattggcacgcctaacacaagatctacagaatattgca
cagtcaacaggatttcagaggcccctcattattggaatatatcaggaaaatggaatgata
agtcgattaggcgacggaatacgaggtactcactttcctggggcgatggctttgggagca
actagatcgccaagtcaagcgttcgatgttgccaaagctacagcaaaagagttggtggct
gtggggatcaactggaactttgctcctctactggatgtgatcagcgaatcaaactcatct
gtgatcggtgtcagggctttcggggatgacccgcaggtggtggggcgttatggtgttgcc
ttcgctgagggactgagggctgggggtatcggccactgtgcgaaacatttccctggcact
ggacagataacaaataaggacggaagtaggagctctactttcaacttcaaaactcgggat
gagctaggcgtaaatgagttgattccctttcggagggcagtatcggccggactggatagt
gtcatgttgacctcctcaatctggggggaaagcctgctaggtgatggaggaactacggtc
ccagccgatgcaaagcatattattcatgaggtacttcggaggcagttgggatacgatggg
ctcacggtgtgcgatgtgacagacatgcctggctatgggcggggactcgatgttagggag
gcggcagtaatagcggttaaggctggttgtgacatgctccaaatatatgacaagccagaa
gcccaaagaaaagcaattgaagcagtatatgaggccattgggactgagaagatagccagg
agcgatatttatcgttcttctagaagggcgctacaactgaaggaacattatttgagttgg
aggacagctctggcggccccagatccccaacgtttatcttctctaatgcaggaacatcag
gctttggcgcgaacggtatacgagaactctataacagtggttcgagacgaaaagtcatta
ctcccattgtcttcacggatcaggagcactgataacatcctccttctgaccccggttgta
agaccactctatcatcgagggccagatgaactccccatagacccatttgagtgtttgggt
cgagccctcgctcgacatcatccgaaagttaggcatgcgccttatacggtgcggggtatc
acctcgacgcatgttgctctcataagacgggcagcagctgttattttcgtggcagctagt
gcgaaccgcccgaataccaattcgcagcttgaaactgccggagcggttcaccgcctctgt
ctgaataaacctctagtaacattagctgcttgtgatccctacgaacttttgactgatagg
acatttgggacatatatctgtacctatgaatattctccgatggccctggaaacagcggct
gctgtgatatttggcgagcgccatgcttcggggtcgctccctatcagtatacctggcacg
ccggcccttcgccaacagcgtttgtggtttgttgaggtatgggaaaagagacgagacctt
tttgcctcagcagacttatggcgagattgcttagggcgaaaatggccactggatgcaagc
acgctcagtgctttgctagatcgtcccggttattcgaaacacttcgtagtccgccgcgcc
atgaccaacgagctcttaggacttgttgcaacctacaccgttatggccggcccctcccaa
cttgtcggaagcctggctttgttaatcgtccgaccttctcatcggaatttggggattggg
ctgtctttgcacgaggtagcagtccggcatttgtccaaacaacaagggatatcatcattg
caacttggaagtatatttccccgcctgtttcctggcttgcccgtcgatttacctagtgag
gatctctcttggtttgcgcatcggggttggaagctcgaagacaaatttctgtacgacctg
tacatgcaaatcgacacatggtcaattccagaagggggcatgcccccactgtatgaaaag
ggggtgtcttttagttgttgcaatgcggatcaattcgatgctttgattgagtttgaagag
aagaattttggcacatatctcggttgggtggacaaataccaggcattgaaggctacggat
gatatagcagatgccatgattgcatacacaagtcaagagatcgtcggagcagctttgatt
ttcagtccagtagggaataatcagatatcaaaagatataccatggccgaagatgatagga
gagcgggtcggtggtatagcttgcatgggtgtcaaagccgaatgcaggggccaaggagtt
ggtcttgggttaatatgtgcttctatcatggagttgaagcagcgtggacttcgaggttgt
ttcgtagactgggccgattttgaagggacttataaagaacttgggttttcgcaatggggc
aagtacagagaaatctggcgcaatgtttaa

DBGET integrated database retrieval system