KEGG   Tuber melanosporum: GSTUM_00005170001Help
Entry
GSTUM_00005170001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
tml  Tuber melanosporum
Brite
Protein phosphatases and associated proteins [BR:tml01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     GSTUM_00005170001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 175 aa AA seqDB search
MGQNPSQIMDNIVSGSNFDHDEVDRLRKRFMKLDKDNSGTIEREEFLSLPQVSSNPLATR
MIAIFDEDGGGDVDFQEFVSGLSAFSSKGNKEEKLRFAFKVYDIDRDGFISNGELFIVLK
MMVGSNLKDQQLQQIVDKTMMEADEDLDGKISFEEFCKMVEHTDVSMSMMTLDQF
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggggcagaatccttctcagattatggacaacattgtctccggctccaattttgatcat
gatgaagtggatcgattgcgcaagaggttcatgaagctggataaggacaactccggcacc
atagagcgagaggaatttctgagcctaccgcaggtctcgtcaaaccccctagccaccagg
atgattgctattttcgacgaagatggtggtggtgatgttgatttccaggagttcgtttcc
ggcttaagcgctttctccagcaaggggaacaaagaagagaagctccggttcgccttcaag
gtctacgacatcgaccgagatggtttcatttccaatggcgaactcttcatcgttctcaag
atgatggtcgggagtaatcttaaggaccagcagctgcagcagatcgtagacaagactatg
atggaggcggacgaggatctggatggcaagatcagctttgaggagttctgtaaaatggtc
gagcacactgacgtctcgatgagcatgatgaccctggatcagttctag

DBGET integrated database retrieval system