KEGG   Tuber melanosporum: GSTUM_00005195001Help
Entry
GSTUM_00005195001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
tml  Tuber melanosporum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 571 aa AA seqDB search
MPATMVALSTRPSKPNKKGVVLPSERERYIQACADIAHRLIQLHEENGGGKDVNLNALRG
QISKKHKLKTIPPLTAIIAAIPEHYKKYIVPKLIAKPIRTSSGIAIVAVMCKPHRCPHIA
YTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFEQARGRVDQLRQLGHSVD
KVEFIIMGGTFMSLPESYRDGFIASLHNALSGYTTENVDEAVRLAEQSETKCVGITIETR
PDYCLDQHLSSMLRYGCTRLEVGVQSLYEDVARDTNRGHTVKAVCETFKLAKDSGYKVVS
HMMPDLPNVGMERDLDQFREYFENPDFRTDGLKIYPTLVIRGTGLYELWRTGRYKNYTPN
ALIDLVARILALVPPWTRIYRVQRDIPMPLVTSGVENGNLRELALSRMKDFGTTCRDVRT
REVGIQEVKNKVRPDQVELIRRDYTANGGWETFLSYEDPKQDILIGLLRLRKCSDRTFRP
ELIGQPTSLVRELHVYGSAVPVHSRNPKKYQHQGYGTLLMEEAERIAREEHGSRKISVIS
GVGVRKYYAKLGYHLDGPYMSKMLDEHKDEN
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgccggctaccatggtggctctgtccacccgaccttcaaaaccgaacaagaaaggcgtg
gtcctcccctccgaacgtgagcgttatatccaggcatgcgccgacattgcccatcgcttg
attcaacttcacgaagagaatggaggagggaaagatgtgaaccttaatgctctaagaggc
cagatttcgaaaaagcataaactgaagacaatcccaccgctcacagctatcattgctgct
attcccgaacactataaaaaatacattgttcccaaactcatagcaaagccaattcgtaca
agttccggaatagctatcgtggcagtcatgtgcaaacctcacagatgtcctcatattgcc
tatacaggaaatatttgtgtttattgccccggaggtccagactcagatttcgagtacagt
acgcaatcatataccggttatgaaccaacctccatgagggcaattcgtgcacgctacgat
ccttttgaacaagctagagggcgtgtggatcagctgcgacaacttgggcatagtgtagac
aaggtcgagtttattattatgggaggcacctttatgtctctcccggaaagctacagggac
gggtttattgcaagtttgcacaacgcgctttcaggatatactacggaaaacgtggatgag
gctgtccgcctagcagaacaatccgagaccaaatgtgtggggattacaatcgaaacaaga
ccagattattgcctcgatcagcacttgagctctatgctacgttatggctgcacacggctc
gaggttggggtccagagtctttacgaggacgtcgcccgagatacaaaccgtggccatacg
gtgaaagctgtatgtgagaccttcaaactggcgaaggattcgggttacaaggttgtgtcg
catatgatgccagatttacccaatgtaggcatggagagagatctggatcaatttagagag
tatttcgagaacccggatttccgaacagacggcctcaagatctatccaactcttgtcatt
cgaggcacaggtctatacgagctctggagaacaggacgatacaagaactacacccccaat
gctctcatcgacctagtcgctcgtatcctagccctcgttcctccatggacccgtatctac
cgagtccagcgcgacatcccgatgccccttgtaacttctggcgtggagaacggtaacctc
cgcgagttggccttgagcaggatgaaagacttcggaacaacctgccgtgacgtgcgtacc
cgtgaagttgggattcaggaggtgaagaacaaggtacggccagatcaagtggagctcatc
agacgagactatacggcgaacggcggatgggagacattcttgagctatgaggatccgaag
caggatatattgatcggactgttacgactacggaagtgctctgatcgaaccttcaggccc
gagctcattggtcagcctacgagcttggttagagagttgcatgtttacgggtctgcggtg
ccagtgcacagtcggaatccgaagaagtatcagcatcaggggtatggcactttactcatg
gaagaggcggaaaggattgccagagaggagcatgggagtagaaagattagtgtgatttcc
ggcgtcggggtacgaaagtactatgctaaacttggatatcacttggacggtccgtacatg
tcgaagatgctggatgagcataaggacgagaattag

DBGET integrated database retrieval system