KEGG   Tuber melanosporum: GSTUM_00005221001Help
Entry
GSTUM_00005221001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
tml  Tuber melanosporum
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    GSTUM_00005221001
Enzymes [BR:tml01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     GSTUM_00005221001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 307 aa AA seqDB search
MAQKQKNNQVLLSTPLHGLYIPVGLILAGTAIIDYNYIPHAAGLALLLGGLKVWRGNART
ILKPDQFQDFELVERTAISHNVGIYRFALPRANDILGLPIGQHVSITATIDGKEIIRSYT
PISSDLDRGHFSLLIKSYPTGNISKYIASLKIGQTIRARGPKGHFVYAPNMVRAFGMIAG
GTGITPMLQIIKAILRNPEDKTQVDLIFANVNVEDILLQEDLDELAAIHDNFRVHYVLNN
PPENWAGGVGFVTADMIKDKCPPAAADVKMLICGPPPMVSAMKKATSALGYEPAKPVSKL
DHQVFCF
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggcacagaaacagaagaataatcaggtgttattgagcacacctctgcacggattgtac
attccggtgggactgatcctcgcgggtacagctattatcgactataactatattccccat
gctgcgggattggctttgcttcttggtgggctaaaggtctggcgaggcaatgcaagaaca
atcctcaagcccgatcaattccaggactttgagctcgtcgagaggaccgcgatctcgcac
aatgtcggaatttatcgtttcgccctccctcgagcaaacgacatcctcggtctcccaatc
ggtcagcatgtctccatcaccgctaccattgacggcaaagaaatcatccgttcctatacc
ccaatctcttccgaccttgaccggggccacttctccctcctcatcaagtcttacccaacc
ggtaacatctcgaagtacatcgcgagcctcaagatcggacagaccatccgcgcgagggga
ccaaaggggcactttgtctacgctcccaacatggtgcgtgcgttcggtatgattgctggt
ggcactggtatcacaccaatgctgcagattatcaaggccattttaagaaaccccgaggac
aaaactcaagtcgaccttatatttgccaacgtcaatgtcgaggatattctcttgcaggag
gacctggacgagctggcggcgattcacgacaatttcagggttcactacgttctcaacaac
ccaccggagaactgggccggcggtgtaggatttgttacagctgacatgattaaggacaaa
tgccccccggctgccgcggacgtcaaaatgctcatttgtggccccccgcccatggtcagc
gccatgaaaaaggctactagtgctcttggatacgaacctgccaagccagtatcaaaatta
gatcaccaggtgttctgtttttaa

DBGET integrated database retrieval system