KEGG   Tuber melanosporum: GSTUM_00005362001Help
Entry
GSTUM_00005362001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
tml  Tuber melanosporum
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tml00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    GSTUM_00005362001
Translation factors [BR:tml03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    GSTUM_00005362001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 718 aa AA seqDB search
MAPRREDEHEDDEEIDFTDLRERYEVQLDEGLDTFVVVDGCPKVPADSRPKLIKLDTNTT
EGYAFVEYNTPDQALLACKQLNGMALDRKHTVSINKLTDIEHFGREGRIKEEYVEPEIEP
FAEQEHLRSWLSDINSRDQFIMYRSENVGVFWNKKKDVPEPVIDRAGWTESFVQWSPQGT
FLTSVHGQGVQLWGGASWKRIMRFAHPIVNLVDFSPNEKYLVTWSNKPISIPENPPPNFP
LGPDEDGKSFIIWDIKTGNLLRSFTSVEVTGDRDAELFEKSRKKVSWPVFKWSSDDKYVA
RVVPEQSIQVFETPSMLLLGKKAIKIEGVVDFEWSPSIPTAEKGKKEPEQLLCYWTPEMN
NQTARVGLMSIPSKEIIRTRNLVNVSDCKLHWQSEGKYLCVKVDRHTKTKKSMYTSLEFF
RVKEKNIPVEIVELKQVVINFAWEPKGDRFVFITVDEAIQGAQVAPKTSVHFYAPEKIKN
GVGEFCLVKTVEKKNSNAIYWSPKGRFALIATVHSQQSFDLEFWDFDFEGEKQKQDKASK
NKDLAANLMLMGTSEHYGLTDVEWDPTGRYVATSASMWKHAMENGYHLWDFKGYLLREEH
IDKFKQFLWRPRPPTMLSKEEQKQIRKNLREYSKQFDEEDQFEADVANKEVLEARKRQLD
EWRAWRARIEKEVRWERVDLGLPEDPEEALREAAGEEEDKVVEEIIEEVISEHEEEIA
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atggcaccccgccgtgaagatgagcatgaggacgacgaagagattgatttcactgatctc
agagagcggtacgaggttcagctcgatgaaggacttgataccttcgttgttgtcgatgga
tgcccgaaggttccggctgatagtagaccgaaactgatcaagttggacacgaacacgacc
gaaggatacgccttcgttgaatacaatacccccgaccaggccttgttagcttgcaagcag
ctcaatggaatggccctcgatagaaagcataccgtttctatcaacaaacttactgatatc
gaacactttgggcgagaagggcgtatcaaggaggagtatgttgaacctgagattgagcct
ttcgccgaacaagaacacctacgctcctggctcagtgatatcaactcccgcgaccagttt
atcatgtaccgcagtgaaaacgttggagtcttctggaataagaagaaggatgtaccggag
cctgtaattgatcgtgcaggatggacagagtcatttgttcaatggtcaccacagggcacc
ttcctaacatctgttcacggtcagggtgtgcagctatggggcggcgcaagctggaagaga
atcatgcgcttcgcccacccaatagtcaacttggtagacttctcgccgaacgaaaaatac
ctagttacgtggtctaacaagcctatctccatccccgagaatccacccccaaatttccct
ctaggacctgacgaagatggaaagagctttattatctgggatatcaagaccggtaacctc
ttgcgatccttcacctctgttgaggtgactggtgaccgtgatgccgaattgttcgagaaa
tcccgtaagaaagtttcgtggccggtgtttaaatggtcctcggacgacaagtacgttgct
cgggttgtgcctgagcagtccattcaggttttcgaaactccaagcatgctattgcttgga
aagaaagccatcaagatcgagggtgttgtcgatttcgagtggtcgccatctattcccact
gccgagaaaggcaaaaaggaaccagagcagttgctttgctactggactcctgagatgaac
aatcaaactgcacgtgttggtctaatgagcattccttcaaaggaaatcatccgaacacga
aatcttgtcaatgtgtcagactgcaagctccattggcagtcagaggggaaatacctttgc
gtcaaggttgaccgacacacaaaaaccaagaaatccatgtacacctccctggagttcttc
cgtgtcaaagaaaagaacattcctgtcgagattgtcgaactaaaacaagttgtcatcaac
ttcgcctgggagcctaagggtgatagatttgtcttcattaccgtcgacgaggctattcag
ggagctcaggttgcacccaagacctcggtccacttctatgcaccggagaaaatcaagaat
ggtgtcggcgaattttgtttagtcaagacggttgaaaagaagaactcaaacgccatctac
tggtcaccaaagggtcgcttcgccctcattgccactgttcactctcagcagagctttgat
ctcgagttttgggatttcgactttgagggcgagaagcagaaacaggacaaggctagtaag
aataaggatcttgctgccaacctcatgcttatgggtacatccgagcactatggtctgact
gatgttgaatgggaccctactggccgatacgtcgccactagtgcgagcatgtggaaacac
gcgatggaaaatggctatcacctctgggacttcaagggctatcttctccgcgaagaacac
attgacaaattcaagcagtttttatggcgtccccgccctcctaccatgctctccaaggaa
gagcagaagcaaatccgcaaaaatctccgtgagtacagcaaacaatttgacgaagaggat
caattcgaagcggatgtcgcaaacaaggaagttcttgaagctcgcaagagacagctcgat
gaatggcgtgcctggagagcaagaattgagaaggaggtcagatgggagcgtgtcgacctc
ggccttcccgaggacccagaggaagccctcagggaagctgccggcgaggaggaggacaag
gttgtcgaggagattatcgaggaggtcatctctgagcacgaggaggagattgcgtaa

DBGET integrated database retrieval system