KEGG   Tuber melanosporum: GSTUM_00005369001Help
Entry
GSTUM_00005369001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
tml  Tuber melanosporum
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:tml00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    GSTUM_00005369001
Exosome [BR:tml04147]
 Exosomal proteins
  Proteins found in most exosomes
   GSTUM_00005369001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 1602 aa AA seqDB search
MHWSKQIIALKAQRTLQIFNLEAKEKLKSHTMNEDVVFWKWISERSLGLVTDNSVYHWDV
MDPSQAAPVKIFDRHMNLSGCQIINYRVNADEKWMVVVGISQSQGRVVGNMQLYSKDRGI
SQAIEGHAAAFASIRLEGASSDTKLFTFAVRTGQGAKLHVVEVDHVAANPVFQKKAVDVY
FPAEAVNDFPVAMQISPRFSIIYLVTKYGFIHLYDLETGACIFMNRISSETIFITAPHEA
SSGIIGVNRKGQVLCVSVDENQIIPYLRENPANSTLAVKLASRAGLAGADELYQKQFQLL
MDQKNFVEAAKVAANSPRGFLRTPATIEQFKSVPAPPGQLSVILQYFGMLLDKTTLNKHE
TIELVKPVLAQNRKHLLEKWLKENKLECTEELGDAVRVHDVNLALSVYLRANVPQKVVAS
FAETGQFDKIVPYAQKVGYSPDYTALLTHIVRINPEKGAEFATQLASQEGGSLVDIDRVV
DVFLSQNMIQQATAFLLTALEGNKPEHAAQQTRLLEMNLLNAPQVADAILLNNMFSYYDR
EKIAKLCENAGLFQRALEHFDDPAAVKRVLCNNSAGLSPEFIVEYFGRMSLEQSLDCMRE
MLRVNIRQNLQVVIQIATKYSDLLGANRLIDLFESFKTFEGLYYYLGSIVNLSEDPDVHF
KYIQAATVCGQMSEVERICRDSNFYNPEKVKNFLKEAKLTEQLPLIVVCDRFNFIHELVL
YLYQNQQFKSIEVYVQRVNPARTPAVVGGLLDVDCEESIIKNLLKSVQSSAIPIDELVAE
VERRNRLKLLLPFLEDTLAAGNQQPAVYNALAKIYIDSNNNPEKFLKENNQYDNLVVGKY
CEKRDPYLAFIAYQKGQNDVELVRITNENSMFKQQARYLVARRDSELWGFVLSPNNIHRR
SLVDQVVATAVPESTDPEDVSVAVQCFLSNDLPTELIELLEKIILEPSTFSDNSSLQNLL
ILTAVKADKARVMDYIHRLTNYDGPDVAHIAIQNGLYEEAFEVYKKINAHSDAINVLIEN
IVSIERAFGYADRVDLPEVWSRLGKAQLDGLRITDSIESYIRAKDPGNYAEVIEIATHAA
KFEDLIKYLQMCRQTLREPAVDSSLVLCYARVDKLPELEEFLNSSNVANIEECGDKAYEE
GLHQAAKVFFSSISNWAKLATTLVFLEEYQNAVECARKANSTKVWKQVNEACVSKKEFRL
AQICGLNLIVHAEELQDLVKQYEHNGYFDELISLLEAGLGLERAHMGMFTELGIALSKYH
PDRVMEHLKLFWGRINIPKMIRACEQAHLWPELIFLYCHYDEWDNAALAMMERAADSWEH
QSFKDIVVKVANLEIYYRALNFYLQEQPSLLTDLLTVLTPRIDVSRVVRMFEKSDNIPLI
KPFLLNVQPQNNKIVNNAINDLLIEEEDYKTLRDSVENYDNYDPIELAQRLEQHELVFFR
QIAANIYRKQKRWNQSIALSKQDRLFKDAIETAAVSGKEDVAEELLRYFVDIGSRECYVG
MLYACYDLIQLDVVMEISWRHGLSDYTMPFMINAMRQQTKKIATLEKDNEERKIKEATQQ
KVEDTTPILGNRLMLTAGPGGPMPQQSYANGIAPQATGFGGF
NT seq 4809 nt NT seq  +upstreamnt  +downstreamnt
atgcactggagcaaacagattatcgccttgaaagcccaacgcacacttcagatcttcaac
ttggaagcaaaagagaagctgaagtcgcatacaatgaatgaggatgttgtcttttggaag
tggattagcgagaggagcttgggccttgttacagataatagcgtttaccattgggatgtt
atggatcctagccaagcggctcctgtcaaaatcttcgaccgacacatgaatctttcgggc
tgccaaattattaactaccgcgtcaatgcggatgagaaatggatggttgtagttggtatt
tctcaatcacaggggcgtgttgtgggtaatatgcagttgtactccaaggatagagggatc
agccaggccatcgaaggtcacgccgctgcattcgcctcgatccgacttgagggggcttcc
tccgacacaaaactattcacatttgctgtccgaacaggtcaaggagctaaactccatgta
gttgaggtagaccatgtcgctgccaaccctgtgttccagaaaaaggctgtcgacgtctac
ttcccagccgaggccgtcaacgattttcccgttgcaatgcagatctcaccaagattttct
atcatatatttggttaccaaatacggtttcatccatttgtacgatcttgagaccggagca
tgcattttcatgaaccgtatttcgagtgagactattttcatcacggcaccccatgaggct
agctccggtatcattggcgtgaaccgaaagggtcaagttctgtgcgtgagtgtcgatgag
aaccaaatcatcccgtatctgcgagagaacccggcgaactcaactcttgccgtcaaactt
gcttcgcgggctggccttgccggcgctgatgagctatatcagaagcaatttcaattactc
atggaccaaaagaattttgtagaggccgccaaagttgccgcaaattctcctcgtggattc
ctgcgtactccagcgaccatcgaacagtttaagtccgtcccagcaccccccggacagctc
tcagtcattctccaatactttggtatgttgttagacaagacgacgttgaacaagcacgaa
accatcgaattggttaagcccgtccttgcacaaaaccggaaacatctgctagagaaatgg
ttgaaggaaaacaaattggaatgcacagaagaactgggagatgccgttagggtccacgat
gtcaacctcgccttgagtgtctatttgcgggccaatgttcctcagaaagttgttgcatcc
tttgccgagacgggacagttcgacaagatcgtgccatatgcacaaaaggttggatacagc
ccagactacacagctttgttgactcatatcgtccgaatcaacccggagaaaggcgccgaa
tttgcaactcagcttgccagtcaggagggtggttccttggttgacattgaccgggtggtg
gatgttttcttgtcacagaatatgattcagcaggcgacggctttcctattaacggcattg
gaaggaaacaagccagagcatgcggcccaacagacccgtttgttagaaatgaacctccta
aatgcaccccaagttgcagatgctattctgttgaataatatgttctcgtactacgatcgt
gaaaagattgcaaagttgtgcgagaacgcgggcctattccagagagctttggaacatttc
gatgatcctgctgcagttaagcgggttctctgcaacaatagtgctgggctttctccagaa
ttcattgttgagtattttgggaggatgtctttggagcaatccttggactgcatgcgagag
atgctgagggttaacattcgtcaaaatctccaagtcgtaattcaaattgcgaccaaatat
tccgaccttttgggtgccaatcgcttgattgaccttttcgagagcttcaaaacatttgag
ggtctctactattaccttggcagtatcgtcaatttgagcgaagatccggatgtgcacttc
aagtacatccaagcggccactgtttgcggtcagatgagtgaggtagagcggatctgtcgc
gatagcaatttctacaatccggagaaggtcaagaattttcttaaggaggcaaagctgact
gaacaacttccattgattgtggtctgcgatcgtttcaattttatccacgagctggtatta
tacctctaccagaaccagcagttcaagtctattgaggtctacgtccagagagttaatccg
gctagaactccagcagtggttggaggactcttggatgttgactgcgaggagtccatcatt
aagaatctgttgaaatctgtccagagctcggcaattcctatcgacgagcttgttgccgaa
gttgagcgtaggaaccgtctaaaacttttgttgccctttttggaggatacattggcagcc
ggaaatcaacaaccagctgtctacaatgcccttgcaaagatatacatcgatagtaacaac
aacccggagaaattcttgaaagagaacaaccagtacgacaatttggtagtcggaaagtac
tgcgaaaagagagacccatacttggcattcattgcataccagaagggtcagaatgatgtt
gaattggttagaattaccaatgagaactcaatgttcaagcagcaggcccggtaccttgta
gcacgccgtgattccgaactgtggggctttgtcttgagccccaataacatccaccgccgt
tctctagtggaccaagttgtcgcaactgccgtccccgaatccactgaccccgaggatgtt
tcagtggctgtgcagtgcttcttgagcaacgacctcccgaccgagttgatcgagcttctt
gagaagattattcttgagccatccacattcagtgataacagcagcctacagaacctgctt
atcctcacggcagttaaagcggataaggcccgcgtaatggactacattcaccgtctcacg
aattacgacggccccgatgtagctcacattgccatccagaatggactctacgaggaggca
tttgaggtctacaaaaagataaatgcacacagtgacgctatcaacgttctcattgaaaac
atagttagcattgaacgcgcctttggctatgctgatcgtgttgatttgcccgaggtatgg
agtcgtctcggtaaggctcagttggacggccttcgtattaccgattctatcgaatcttat
atccgagctaaggaccctggcaactatgcggaggttatcgagatagctactcatgctgca
aagttcgaggatctcatcaaatatcttcaaatgtgcagacagaccctgagagagccagct
gttgatagtagcttggttctgtgttatgctagggttgataaattgcctgagctggaggag
ttcctaaatagctcgaacgttgccaatatcgaggagtgtggtgacaaggcatacgaagag
gggcttcaccaggccgccaaagtcttcttctcgagcatttccaactgggccaaattggct
actactctcgtattcttggaagagtaccaaaatgctgtcgagtgcgcccgtaaagccaat
agcactaaagtatggaagcaagtcaacgaggcctgtgtttccaagaaggagttccgtctt
gcacagatttgcggtctcaacctgatcgtccatgcagaagagttgcaagatcttgtcaag
caatacgaacataacgggtattttgacgagttgatcagcctcctcgaggctggattgggt
ttggagagggcccatatgggtatgtttactgagttgggtattgccctctcaaaataccat
cccgatcgtgtaatggaacatcttaagttgttctggggccgtatcaacattccaaagatg
attcgtgcttgcgagcaagctcatctttggcctgaactcatctttctgtattgccactat
gacgaatgggacaatgctgctttggcgatgatggagagagcagcagattcatgggagcac
cagtcattcaaggatattgttgtcaaggttgccaacctggagatttactaccgtgccttg
aacttttacctgcaggagcaaccttccctgcttaccgatttgctgactgttctcacacct
cgcattgatgtttcccgtgttgtgcgaatgtttgagaaatcggacaatattcctcttatc
aagccgtttttgctcaatgttcagcctcaaaataacaagatcgtcaacaacgctattaac
gatttgttgattgaagaggaagattataagacacttcgtgattcggtcgagaactatgac
aactatgacccgattgaacttgctcagcgtctcgagcaacacgaacttgtcttctttagg
cagatcgccgccaatatctaccgcaagcagaaacgttggaaccaatctattgccctatca
aagcaggataggctcttcaaggatgctattgagactgctgctgtatccggaaaggaagat
gtggcggaggagttacttcgttacttcgtcgacattggtagccgggagtgctatgttggt
atgctttacgcctgttacgatcttatccagcttgatgttgtcatggagatctcgtggcgc
catggcttgagtgactacacaatgcctttcatgatcaatgccatgagacagcaaaccaag
aagattgctactctcgagaaggacaatgaagagcgtaagatcaaggaggctacccagcaa
aaggtcgaagacactactccgattctcggaaatcgtcttatgctcaccgccggaccgggt
ggccctatgccacaacaatcatacgctaacgggattgcaccgcaagctactgggtttgga
gggttttag

DBGET integrated database retrieval system