KEGG   Tuber melanosporum: GSTUM_00005402001Help
Entry
GSTUM_00005402001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
tml  Tuber melanosporum
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    GSTUM_00005402001
  Metabolism of other amino acids
   00480 Glutathione metabolism
    GSTUM_00005402001
Enzymes [BR:tml01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     GSTUM_00005402001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 158 aa AA seqDB search
MSSATTFYDLEPLDSRNQPYTFNQLKGKVVLIVNVASKYQYEGLEKLYEKYKDQGLEVLG
ARDRRGDPRCKRVNYGVKFPVLAKIDVNGGDASPVYKWLKDEKAGLLGIKLIKWNYEKFL
VSREGKVVDRYASTTKPDSLASAIEKELNKGTPPKAEL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccgctaccactttctatgatcttgagccccttgactctagaaatcaaccctat
accttcaaccagttgaaagggaaggtggttctcattgtcaatgttgctagcaagtaccaa
tacgagggccttgagaaactttacgagaagtacaaagaccaggggctcgaagtgcttgga
gccagggacagacgaggagatccaagatgtaagagggtcaattacggcgttaagttccct
gttctcgccaagatcgacgtcaacgggggtgatgcttctccggtctacaaatggctcaaa
gatgagaaggcgggccttttgggaataaagctcataaaatggaactatgagaaattcctc
gtttccagggaaggaaaggtggttgaccgctatgcctccactacgaagcccgactcgttg
gcctctgctatcgagaaggagctcaataagggcactcccccgaaagctgaattgtag

DBGET integrated database retrieval system