KEGG   Tuber melanosporum: GSTUM_00005852001Help
Entry
GSTUM_00005852001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
tml  Tuber melanosporum
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:tml00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    GSTUM_00005852001
Enzymes [BR:tml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     GSTUM_00005852001
Protein kinases [BR:tml01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   GSTUM_00005852001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 332 aa AA seqDB search
MAEFVRAQIFGTTFEITSRYTDLQPVGMGAFGLVCSAKDQLTTQSVAIKKIMKPFSTPVL
SKRTYRELKLLKHLRHENVISLSDIFISPLEDIYFVTELLGTDLHRLLTSRPLEKQFIQY
FLYQILRGLKYVHSAGVVHRDLKPSNILVNENCDLKICDFGLARIQDPQMTGYVSTRYYR
APEIMLTWQKYDVEVDIWSAGCIFAEMLEGKPLFPGKDHVNQFSIITELLGTPPDDPYPP
LFSIRPVPPKEGAPTSFREIQKRRSACNRLVGTHAPLAHEYLAPYHDPTDEPVAGEKFDW
SFNDADLPVDTWKIMMYSEILDYHNVDGSAQS
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggctgaattcgtccgcgctcagatctttggaacaactttcgagattacaagcagatac
actgatctgcaacccgtgggcatgggtgcctttggtctcgtctgctccgccaaagatcag
ctgaccactcagtccgtcgctataaagaagatcatgaagcccttcagcacgccggttttg
tccaagagaacttaccgtgagctgaaactgctcaagcacttgcggcatgagaatgtcatt
agtcttagcgatatcttcatatctcctctggaggacatttacttcgtcactgagcttctt
ggtactgatctgcaccgattattaacctctcggccgttggaaaagcagttcatccagtac
tttctataccagattctgcgcggactgaaatacgttcattccgctggcgtcgttcatcgt
gacctgaaacctagcaacattttagtcaacgagaattgtgatctcaaaatctgcgatttc
ggtcttgctcggattcaggatccccagatgaccggctatgtctctacaaggtactaccgc
gcaccggagattatgctcacatggcaaaagtacgatgtcgaggtggatatctggagtgcg
ggatgtatatttgcggagatgctcgaaggaaagccgctgttcccagggaaagaccacgtc
aaccagttctcgattatcactgagcttcttggaactccccctgatgatccttatcccccc
cttttttccattcgtccagtccctcccaaagagggagcgccaacctctttccgagaaatt
caaaaacgcagatccgcttgcaatcgacttgttggaacacatgctcctttggcccacgaa
tatttggcaccttaccatgatcctacggacgagccggtggcaggagagaagttcgattgg
tccttcaacgatgcagacctgcccgttgatacatggaaaatcatgatgtactcagagatt
ttggattatcacaatgtagatgggtccgctcagtcatag

DBGET integrated database retrieval system