KEGG   Tuber melanosporum: GSTUM_00006862001Help
Entry
GSTUM_00006862001 CDS       T01282                                 

Definition
(RefSeq) hypothetical protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
tml  Tuber melanosporum
Pathway
tml00010  Glycolysis / Gluconeogenesis
tml00071  Fatty acid degradation
tml00350  Tyrosine metabolism
tml01100  Metabolic pathways
tml01110  Biosynthesis of secondary metabolites
tml01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GSTUM_00006862001
  Lipid metabolism
   00071 Fatty acid degradation
    GSTUM_00006862001
  Amino acid metabolism
   00350 Tyrosine metabolism
    GSTUM_00006862001
Enzymes [BR:tml01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     GSTUM_00006862001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C adh_short ACP_syn_III_C
Motif
Other DBs
NCBI-GeneID: 9188191
NCBI-ProteinID: XP_002839052
INRA: GSTUM_00006862001
UniProt: D5GFF0
AA seq 349 aa AA seqDB search
MSVPTEQYAQVFKSNNDPIERKKVPVSKPGPDEVLVNIKYTGVCHTDLHAWKGDWPLQTK
QNLIGGHEGAGVVVAVGELVKDIKVGDHAGIKWINGSCGHCEFCMAGDEPLCTNALLSGY
TVDGSFQQYAIGKAVDVARIPKGVPLDAVAPILCAGITVYKALKESQARAGQTIAIVGAG
GGLGSLAVQYAKAMGFRVIAIDTGSEKQEMCLNVLGAEEYVDFAKEDVGAKVKSITGGLG
AHAVILLAVSEKPFQHATEYCRAHGTVVCVGLPAKARISAEVFPTVIRMITIKGSYVGNR
IDTHEAIDFFARGLIKAPFKVGKLSELPQVFKLMEEGKIAGRYVLDTSK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtccccaccgaacaatacgcgcaagtctttaagagcaacaatgatccaattgag
agaaaaaaggttcccgtctcaaaaccaggcccagatgaggttttggtcaacatcaaatat
actggagtttgccataccgaccttcacgcatggaagggtgactggcccttgcaaactaaa
caaaacctgattggcggtcacgaaggtgctggtgttgtcgtcgctgttggcgaattggtt
aaggacatcaaagtaggcgaccatgcgggcatcaagtggatcaacgggagttgcggccat
tgcgaattctgtatggctggcgacgagcccttatgcacaaatgctctgctctcgggatac
accgtggatggcagcttccagcaatacgcgattggcaaagccgtagatgtcgctagaatt
cccaaaggagttccattagacgcagttgctcctatcctctgcgccggaatcaccgtttac
aaagcccttaaagagtcccaagcccgtgcaggtcaaaccatagccatcgtcggtgctggc
ggtggtcttggatcgcttgctgtgcaatacgccaaagcgatgggttttcgtgttatagct
atcgatactggaagcgaaaagcaagaaatgtgtctcaatgtactcggtgccgaggaatac
gtggactttgcgaaagaagatgtaggagcaaaggtcaaatctataaccgggggtctaggt
gcccatgctgtcatccttctcgctgtgagcgagaagcccttccaacatgccaccgagtac
tgccgggctcatggaacagtagtctgcgtgggtctccccgccaaagcccgcatttcagcc
gaagtattcccgaccgttatccgaatgatcaccatcaagggatcctacgttggcaaccgc
atcgacacccatgaggcaatcgacttcttcgcccgcggcctcatcaaagcccccttcaaa
gtcggaaagctctctgagctccctcaagtcttcaaactcatggaggaaggcaaaattgca
gggcgctatgttcttgatacaagcaaatga

DBGET integrated database retrieval system